Chr1 - 46 clusters - antiSMASH results

Identified secondary metabolite clusters

Search by locus tag, Pfam ID, or biosynthetic type:

Cluster	Record	Type	From	To	Size (kb)	Core domains	CD-HIT Clusters	Genes	Most similar known cluster	MIBiG BGC-ID
Cluster 1	Chr1	Saccharide	13206187	13260490	54.30	FA_desaturase, Glycos_transf_1	3	Pdr1g007110, Pdr1g007120, Pdr1g007130, Pdr1g007140, Pdr1g007150, Pdr1g007160, Pdr1g007170, Pdr1g007180, Pdr1g007190	-	-
Cluster 2	Chr1	Lignan-Polyketide	16824965	16866175	41.21	Chal_sti_synt_C, Dirigent	3	Pdr1g010970, Pdr1g010980, Pdr1g010990, Pdr1g011000, Pdr1g011010, Pdr1g011020, Pdr1g011030	-	-
Cluster 3	Chr10	Terpene	1618665	1861471	242.81	Epimerase, Terpene_synth, Terpene_synth_C	4	Pdr10g002280, Pdr10g002290, Pdr10g002300, Pdr10g002310, Pdr10g002320, Pdr10g002330, Pdr10g002340, Pdr10g002350, Pdr10g002360, Pdr10g002370, Pdr10g002380, Pdr10g002390, Pdr10g002400, Pdr10g002410, Pdr10g002420, Pdr10g002430, Pdr10g002440, Pdr10g002450, Pdr10g002460, Pdr10g002470, Pdr10g002480, Pdr10g002490	-	-
Cluster 4	Chr10	Cyclopeptide	22973483	23785221	811.74	BURP	1	Pdr10g022260, Pdr10g022270, Pdr10g022280, Pdr10g022290, Pdr10g022300, Pdr10g022310, Pdr10g022320, Pdr10g022330, Pdr10g022340, Pdr10g022350, Pdr10g022360, Pdr10g022370, Pdr10g022380, Pdr10g022390, Pdr10g022400, Pdr10g022410, Pdr10g022420, Pdr10g022430, Pdr10g022440, Pdr10g022450, Pdr10g022460, Pdr10g022470, Pdr10g022480, Pdr10g022490, Pdr10g022500, Pdr10g022510, Pdr10g022520, Pdr10g022530, Pdr10g022540, Pdr10g022550, Pdr10g022560, Pdr10g022570, Pdr10g022580, Pdr10g022590, Pdr10g022600, Pdr10g022610, Pdr10g022620, Pdr10g022630, Pdr10g022640, Pdr10g022650, Pdr10g022660, Pdr10g022670, Pdr10g022680, Pdr10g022690, Pdr10g022700, Pdr10g022710, Pdr10g022720, Pdr10g022730, Pdr10g022740, Pdr10g022750, Pdr10g022760, Pdr10g022770, Pdr10g022780, Pdr10g022790, Pdr10g022800, Pdr10g022810, Pdr10g022820, Pdr10g022830	-	-
Cluster 5	Chr11	Putative	2917673	3099809	182.14	2OG-FeII_Oxy, Transferase, p450, polyprenyl_synt	5	Pdr11g003910, Pdr11g003920, Pdr11g003930, Pdr11g003940, Pdr11g003950, Pdr11g003960, Pdr11g003970, Pdr11g003980, Pdr11g003990, Pdr11g004000, Pdr11g004010, Pdr11g004020, Pdr11g004030, Pdr11g004040, Pdr11g004050, Pdr11g004060, Pdr11g004070, Pdr11g004080	-	-
Cluster 6	Chr11	Terpene	6464068	6540725	76.66	Terpene_synth, Terpene_synth_C, p450	4	Pdr11g007330, Pdr11g007340, Pdr11g007350, Pdr11g007360, Pdr11g007370, Pdr11g007380, Pdr11g007390, Pdr11g007400, Pdr11g007410, Pdr11g007420, Pdr11g007430, Pdr11g007440, Pdr11g007450, Pdr11g007460	-	-
Cluster 7	Chr11	Lignan-Polyketide	22929785	23044112	114.33	Chal_sti_synt_C, Dirigent, p450	3	Pdr11g017930, Pdr11g017940, Pdr11g017950, Pdr11g017960, Pdr11g017970, Pdr11g017980, Pdr11g017990, Pdr11g018000, Pdr11g018010	-	-
Cluster 8	Chr12	Saccharide	21027445	21100190	72.75	ERG4_ERG24, Glycos_transf_2, Methyltransf_11	3	Pdr12g018440, Pdr12g018450, Pdr12g018460, Pdr12g018470, Pdr12g018480, Pdr12g018490, Pdr12g018500, Pdr12g018510, Pdr12g018520	-	-
Cluster 9	Chr14	Cyclopeptide	1179647	1563081	383.43	BURP	2	Pdr14g001280, Pdr14g001290, Pdr14g001300, Pdr14g001310, Pdr14g001320, Pdr14g001330, Pdr14g001340, Pdr14g001350, Pdr14g001360, Pdr14g001370, Pdr14g001380, Pdr14g001390, Pdr14g001400, Pdr14g001410, Pdr14g001420, Pdr14g001430, Pdr14g001440, Pdr14g001450, Pdr14g001460, Pdr14g001470, Pdr14g001480, Pdr14g001490, Pdr14g001500, Pdr14g001510, Pdr14g001520, Pdr14g001530, Pdr14g001540, Pdr14g001550, Pdr14g001560, Pdr14g001570, Pdr14g001580, Pdr14g001590, Pdr14g001600, Pdr14g001610, Pdr14g001620, Pdr14g001630	-	-
Cluster 10	Chr14	Saccharide	18772270	18908595	136.32	Cellulose_synt, UDPGT_2	3	Pdr14g012670, Pdr14g012680, Pdr14g012690, Pdr14g012700, Pdr14g012710, Pdr14g012720, Pdr14g012730, Pdr14g012740	-	-
Cluster 11	Chr15	Putative	14523970	14743507	219.54	Aminotran_1_2, SE, adh_short	4	Pdr15g008370, Pdr15g008380, Pdr15g008390, Pdr15g008400, Pdr15g008410, Pdr15g008420, Pdr15g008430, Pdr15g008440, Pdr15g008450, Pdr15g008460, Pdr15g008470, Pdr15g008480, Pdr15g008490, Pdr15g008500, Pdr15g008510	-	-
Cluster 12	Chr15	Putative	19438300	19536073	97.77	Methyltransf_7, p450	4	Pdr15g012550, Pdr15g012560, Pdr15g012570, Pdr15g012580, Pdr15g012590, Pdr15g012600, Pdr15g012610, Pdr15g012620, Pdr15g012630	-	-
Cluster 13	Chr15	Alkaloid	20686755	20731620	44.87	AMP-binding, Str_synth	3	Pdr15g013820, Pdr15g013830, Pdr15g013840, Pdr15g013850, Pdr15g013860, Pdr15g013870	-	-
Cluster 14	Chr15	Cyclopeptide	21151956	21450430	298.47	BURP	1	Pdr15g014390, Pdr15g014400, Pdr15g014410, Pdr15g014420, Pdr15g014430, Pdr15g014440, Pdr15g014450, Pdr15g014460, Pdr15g014470, Pdr15g014480, Pdr15g014490, Pdr15g014500, Pdr15g014510, Pdr15g014520, Pdr15g014530, Pdr15g014540, Pdr15g014550, Pdr15g014560, Pdr15g014570, Pdr15g014580, Pdr15g014590, Pdr15g014600, Pdr15g014610, Pdr15g014620, Pdr15g014630, Pdr15g014640, Pdr15g014650, Pdr15g014660, Pdr15g014670, Pdr15g014680	-	-
Cluster 15	Chr15	Cyclopeptide	28295703	28738387	442.68	BURP	1	Pdr15g023820, Pdr15g023830, Pdr15g023840, Pdr15g023850, Pdr15g023860, Pdr15g023870, Pdr15g023880, Pdr15g023890, Pdr15g023900, Pdr15g023910, Pdr15g023920, Pdr15g023930, Pdr15g023940, Pdr15g023950, Pdr15g023960, Pdr15g023970, Pdr15g023980, Pdr15g023990, Pdr15g024000, Pdr15g024010, Pdr15g024020, Pdr15g024030, Pdr15g024040, Pdr15g024050, Pdr15g024060, Pdr15g024070, Pdr15g024080, Pdr15g024090, Pdr15g024100, Pdr15g024110, Pdr15g024120, Pdr15g024130, Pdr15g024140, Pdr15g024150, Pdr15g024160, Pdr15g024170, Pdr15g024180, Pdr15g024190, Pdr15g024200, Pdr15g024210, Pdr15g024220, Pdr15g024230, Pdr15g024240, Pdr15g024250, Pdr15g024260, Pdr15g024270, Pdr15g024280, Pdr15g024290, Pdr15g024300, Pdr15g024310, Pdr15g024320, Pdr15g024330, Pdr15g024340, Pdr15g024350, Pdr15g024360, Pdr15g024370, Pdr15g024380, Pdr15g024390, Pdr15g024400, Pdr15g024410, Pdr15g024420, Pdr15g024430, Pdr15g024440, Pdr15g024450, Pdr15g024460, Pdr15g024470	-	-
Cluster 16	Chr16	Cyclopeptide	5484141	5800793	316.65	BURP	1	Pdr16g007620, Pdr16g007630, Pdr16g007640, Pdr16g007650, Pdr16g007660, Pdr16g007670, Pdr16g007680, Pdr16g007690, Pdr16g007700, Pdr16g007710, Pdr16g007720, Pdr16g007730, Pdr16g007740, Pdr16g007750, Pdr16g007760, Pdr16g007770, Pdr16g007780, Pdr16g007790, Pdr16g007800, Pdr16g007810, Pdr16g007820, Pdr16g007830, Pdr16g007840, Pdr16g007850, Pdr16g007860, Pdr16g007870, Pdr16g007880, Pdr16g007890, Pdr16g007900, Pdr16g007910, Pdr16g007920, Pdr16g007930, Pdr16g007940, Pdr16g007950, Pdr16g007960, Pdr16g007970, Pdr16g007980, Pdr16g007990, Pdr16g008000, Pdr16g008010, Pdr16g008020, Pdr16g008030, Pdr16g008040, Pdr16g008050, Pdr16g008060, Pdr16g008070, Pdr16g008080, Pdr16g008090	-	-
Cluster 17	Chr16	Alkaloid	11455278	11600386	145.11	Cu_amine_oxid, Lipoxygenase	3	Pdr16g014570, Pdr16g014580, Pdr16g014590, Pdr16g014600, Pdr16g014610, Pdr16g014620, Pdr16g014630, Pdr16g014640, Pdr16g014650, Pdr16g014660, Pdr16g014670	-	-
Cluster 18	Chr17	Terpene	4324206	4469419	145.21	Terpene_synth, Terpene_synth_C	3	Pdr17g005410, Pdr17g005420, Pdr17g005430, Pdr17g005440, Pdr17g005450, Pdr17g005460, Pdr17g005470, Pdr17g005480, Pdr17g005490, Pdr17g005500, Pdr17g005510, Pdr17g005520, Pdr17g005530, Pdr17g005540	-	-
Cluster 19	Chr17	Saccharide	6187632	6574942	387.31	Epimerase, UDPGT_2	4	Pdr17g007360, Pdr17g007370, Pdr17g007380, Pdr17g007390, Pdr17g007400, Pdr17g007410, Pdr17g007420, Pdr17g007430, Pdr17g007440, Pdr17g007450, Pdr17g007460, Pdr17g007470, Pdr17g007480, Pdr17g007490, Pdr17g007500, Pdr17g007510, Pdr17g007520, Pdr17g007530, Pdr17g007540, Pdr17g007550, Pdr17g007560, Pdr17g007570, Pdr17g007580, Pdr17g007590, Pdr17g007600, Pdr17g007610, Pdr17g007620, Pdr17g007630, Pdr17g007640	-	-
Cluster 20	Chr17	Saccharide	6597429	6735642	138.21	Aminotran_3, UDPGT_2, p450	3	Pdr17g007690, Pdr17g007700, Pdr17g007710, Pdr17g007720, Pdr17g007730, Pdr17g007740, Pdr17g007750, Pdr17g007760, Pdr17g007770, Pdr17g007780, Pdr17g007790, Pdr17g007800, Pdr17g007810, Pdr17g007820, Pdr17g007830, Pdr17g007840, Pdr17g007850	-	-
Cluster 21	Chr3	Terpene	13434850	13538446	103.60	Terpene_synth_C, p450	3	Pdr3g009030, Pdr3g009040, Pdr3g009050, Pdr3g009060, Pdr3g009070, Pdr3g009080, Pdr3g009090, Pdr3g009100, Pdr3g009110, Pdr3g009120, Pdr3g009130, Pdr3g009140	-	-
Cluster 22	Chr3	Terpene	15511742	15670145	158.40	2OG-FeII_Oxy, Epimerase, Methyltransf_11, Terpene_synth, Terpene_synth_C, adh_short_C2, p450	6	Pdr3g011350, Pdr3g011360, Pdr3g011370, Pdr3g011380, Pdr3g011390, Pdr3g011400, Pdr3g011410, Pdr3g011420, Pdr3g011430, Pdr3g011440, Pdr3g011450, Pdr3g011460, Pdr3g011470, Pdr3g011480, Pdr3g011490, Pdr3g011500, Pdr3g011510, Pdr3g011520, Pdr3g011530, Pdr3g011540, Pdr3g011550	-	-
Cluster 23	Chr3	Terpene	22229674	22348512	118.84	2OG-FeII_Oxy, DIOX_N, PRISE, Prenyltransf	3	Pdr3g019070, Pdr3g019080, Pdr3g019090, Pdr3g019100, Pdr3g019110, Pdr3g019120, Pdr3g019130, Pdr3g019140, Pdr3g019150, Pdr3g019160, Pdr3g019170, Pdr3g019180, Pdr3g019190, Pdr3g019200	-	-
Cluster 24	Chr4	Saccharide	21806535	21997222	190.69	AMP-binding, Amino_oxidase, UDPGT_2	3	Pdr4g020190, Pdr4g020200, Pdr4g020210, Pdr4g020220, Pdr4g020230, Pdr4g020240, Pdr4g020250, Pdr4g020260, Pdr4g020270, Pdr4g020280, Pdr4g020290, Pdr4g020300, Pdr4g020310, Pdr4g020320, Pdr4g020330, Pdr4g020340, Pdr4g020350	-	-
Cluster 25	Chr4	Cyclopeptide	22305725	22600500	294.77	BURP	1	Pdr4g020690, Pdr4g020700, Pdr4g020710, Pdr4g020720, Pdr4g020730, Pdr4g020740, Pdr4g020750, Pdr4g020760, Pdr4g020770, Pdr4g020780, Pdr4g020790, Pdr4g020800, Pdr4g020810, Pdr4g020820, Pdr4g020830, Pdr4g020840, Pdr4g020850, Pdr4g020860, Pdr4g020870, Pdr4g020880, Pdr4g020890, Pdr4g020900, Pdr4g020910, Pdr4g020920, Pdr4g020930, Pdr4g020940, Pdr4g020950, Pdr4g020960, Pdr4g020970	-	-
Cluster 26	Chr5	Cyclopeptide	8404514	9284703	880.19	BURP	2	Pdr5g006670, Pdr5g006680, Pdr5g006690, Pdr5g006700, Pdr5g006710, Pdr5g006720, Pdr5g006730, Pdr5g006740, Pdr5g006750, Pdr5g006760, Pdr5g006770, Pdr5g006780, Pdr5g006790, Pdr5g006800, Pdr5g006810, Pdr5g006820, Pdr5g006830, Pdr5g006840, Pdr5g006850, Pdr5g006860, Pdr5g006870, Pdr5g006880, Pdr5g006890, Pdr5g006900, Pdr5g006910, Pdr5g006920, Pdr5g006930, Pdr5g006940, Pdr5g006950, Pdr5g006960, Pdr5g006970, Pdr5g006980, Pdr5g006990, Pdr5g007000, Pdr5g007010, Pdr5g007020, Pdr5g007030, Pdr5g007040, Pdr5g007050, Pdr5g007060, Pdr5g007070, Pdr5g007080, Pdr5g007090, Pdr5g007100, Pdr5g007110, Pdr5g007120, Pdr5g007130	-	-
Cluster 27	Chr5	Cyclopeptide	9075805	10127570	1051.77	BURP	1	Pdr5g007050, Pdr5g007060, Pdr5g007070, Pdr5g007080, Pdr5g007090, Pdr5g007100, Pdr5g007110, Pdr5g007120, Pdr5g007130, Pdr5g007140, Pdr5g007150, Pdr5g007160, Pdr5g007170, Pdr5g007180, Pdr5g007190, Pdr5g007200, Pdr5g007210, Pdr5g007220, Pdr5g007230, Pdr5g007240, Pdr5g007250, Pdr5g007260, Pdr5g007270, Pdr5g007280, Pdr5g007290, Pdr5g007300, Pdr5g007310, Pdr5g007320, Pdr5g007330, Pdr5g007340, Pdr5g007350, Pdr5g007360, Pdr5g007370, Pdr5g007380, Pdr5g007390, Pdr5g007400, Pdr5g007410, Pdr5g007420, Pdr5g007430, Pdr5g007440, Pdr5g007450, Pdr5g007460, Pdr5g007470, Pdr5g007480, Pdr5g007490	-	-
Cluster 28	Chr5	Putative	23437894	23493063	55.17	Transferase, adh_short_C2	4	Pdr5g018490, Pdr5g018500, Pdr5g018510, Pdr5g018520, Pdr5g018530, Pdr5g018540	-	-
Cluster 29	Chr6	Putative	17414740	17557303	142.56	AMP-binding, adh_short, p450	4	Pdr6g012420, Pdr6g012430, Pdr6g012440, Pdr6g012450, Pdr6g012460, Pdr6g012470, Pdr6g012480, Pdr6g012490, Pdr6g012500, Pdr6g012510, Pdr6g012520, Pdr6g012530, Pdr6g012540, Pdr6g012550, Pdr6g012560	-	-
Cluster 30	Chr6	Cyclopeptide	18724724	19046055	321.33	BURP	1	Pdr6g014100, Pdr6g014110, Pdr6g014120, Pdr6g014130, Pdr6g014140, Pdr6g014150, Pdr6g014160, Pdr6g014170, Pdr6g014180, Pdr6g014190, Pdr6g014200, Pdr6g014210, Pdr6g014220, Pdr6g014230, Pdr6g014240, Pdr6g014250, Pdr6g014260, Pdr6g014270, Pdr6g014280, Pdr6g014290, Pdr6g014300, Pdr6g014310, Pdr6g014320, Pdr6g014330, Pdr6g014340, Pdr6g014350, Pdr6g014360, Pdr6g014370, Pdr6g014380, Pdr6g014390, Pdr6g014400, Pdr6g014410, Pdr6g014420, Pdr6g014430, Pdr6g014440, Pdr6g014450, Pdr6g014460	-	-
Cluster 31	Chr7	Putative	6163058	6384414	221.36	Transferase, p450	4	Pdr7g006090, Pdr7g006100, Pdr7g006110, Pdr7g006120, Pdr7g006130, Pdr7g006140, Pdr7g006150, Pdr7g006160, Pdr7g006170, Pdr7g006180, Pdr7g006190, Pdr7g006200, Pdr7g006210	-	-
Cluster 32	Chr7	Saccharide	14931204	15206256	275.05	Epimerase, FA_desaturase, Glycos_transf_1, adh_short_C2	4	Pdr7g010130, Pdr7g010140, Pdr7g010150, Pdr7g010160, Pdr7g010170, Pdr7g010180, Pdr7g010190, Pdr7g010200, Pdr7g010210, Pdr7g010220, Pdr7g010230, Pdr7g010240, Pdr7g010250, Pdr7g010260, Pdr7g010270, Pdr7g010280, Pdr7g010290, Pdr7g010300, Pdr7g010310, Pdr7g010320, Pdr7g010330, Pdr7g010340	-	-
Cluster 33	Chr8	Saccharide	389675	468160	78.48	Aminotran_1_2, Glycos_transf_2, SE	3	Pdr8g000520, Pdr8g000530, Pdr8g000540, Pdr8g000550, Pdr8g000560, Pdr8g000570, Pdr8g000580, Pdr8g000590	-	-
Cluster 34	Chr8	Saccharide	659963	737092	77.13	Aminotran_1_2, Glycos_transf_2, SE	3	Pdr8g000770, Pdr8g000780, Pdr8g000790, Pdr8g000800, Pdr8g000810, Pdr8g000820, Pdr8g000830, Pdr8g000840, Pdr8g000850, Pdr8g000860	-	-
Cluster 35	Chr8	Polyketide	6188712	6269725	81.01	Chal_sti_synt_N, Epimerase	3	Pdr8g007590, Pdr8g007600, Pdr8g007610, Pdr8g007620, Pdr8g007630, Pdr8g007640, Pdr8g007650, Pdr8g007660, Pdr8g007670, Pdr8g007680, Pdr8g007690	-	-
Cluster 36	Chr8	Cyclopeptide	10058614	10483929	425.31	BURP	1	Pdr8g011400, Pdr8g011410, Pdr8g011420, Pdr8g011430, Pdr8g011440, Pdr8g011450, Pdr8g011460, Pdr8g011470, Pdr8g011480, Pdr8g011490, Pdr8g011500, Pdr8g011510, Pdr8g011520, Pdr8g011530, Pdr8g011540, Pdr8g011550, Pdr8g011560, Pdr8g011570, Pdr8g011580, Pdr8g011590, Pdr8g011600, Pdr8g011610, Pdr8g011620, Pdr8g011630, Pdr8g011640, Pdr8g011650, Pdr8g011660, Pdr8g011670, Pdr8g011680, Pdr8g011690, Pdr8g011700, Pdr8g011710, Pdr8g011720	-	-
Cluster 37	Chr8	Saccharide	11803338	12055228	251.89	DAHP_synth_2, UDPGT_2	3	Pdr8g012680, Pdr8g012690, Pdr8g012700, Pdr8g012710, Pdr8g012720, Pdr8g012730, Pdr8g012740, Pdr8g012750, Pdr8g012760, Pdr8g012770, Pdr8g012780, Pdr8g012790, Pdr8g012800, Pdr8g012810, Pdr8g012820, Pdr8g012830	-	-
Cluster 38	Chr8	Cyclopeptide	22857196	23400314	543.12	BURP	2	Pdr8g018970, Pdr8g018980, Pdr8g018990, Pdr8g019000, Pdr8g019010, Pdr8g019020, Pdr8g019030, Pdr8g019040, Pdr8g019050, Pdr8g019060, Pdr8g019070, Pdr8g019080, Pdr8g019090, Pdr8g019100, Pdr8g019110, Pdr8g019120, Pdr8g019130, Pdr8g019140, Pdr8g019150, Pdr8g019160, Pdr8g019170, Pdr8g019180, Pdr8g019190, Pdr8g019200, Pdr8g019210, Pdr8g019220, Pdr8g019230, Pdr8g019240, Pdr8g019250, Pdr8g019260, Pdr8g019270, Pdr8g019280, Pdr8g019290, Pdr8g019300, Pdr8g019310, Pdr8g019320, Pdr8g019330, Pdr8g019340, Pdr8g019350, Pdr8g019360, Pdr8g019370, Pdr8g019380, Pdr8g019390, Pdr8g019400, Pdr8g019410, Pdr8g019420, Pdr8g019430, Pdr8g019440, Pdr8g019450, Pdr8g019460, Pdr8g019470, Pdr8g019480, Pdr8g019490, Pdr8g019500	-	-
Cluster 39	Chr8	Cyclopeptide	23999577	24470208	470.63	BURP	1	Pdr8g019990, Pdr8g020000, Pdr8g020010, Pdr8g020020, Pdr8g020030, Pdr8g020040, Pdr8g020050, Pdr8g020060, Pdr8g020070, Pdr8g020080, Pdr8g020090, Pdr8g020100, Pdr8g020110, Pdr8g020120, Pdr8g020130, Pdr8g020140, Pdr8g020150, Pdr8g020160, Pdr8g020170, Pdr8g020180, Pdr8g020190, Pdr8g020200, Pdr8g020210, Pdr8g020220, Pdr8g020230, Pdr8g020240, Pdr8g020250, Pdr8g020260, Pdr8g020270, Pdr8g020280, Pdr8g020290, Pdr8g020300, Pdr8g020310, Pdr8g020320, Pdr8g020330, Pdr8g020340, Pdr8g020350, Pdr8g020360	-	-
Cluster 40	Chr9	Saccharide	15542742	15687238	144.50	Epimerase, UDPGT_2	4	Pdr9g011580, Pdr9g011590, Pdr9g011600, Pdr9g011610, Pdr9g011620, Pdr9g011630, Pdr9g011640, Pdr9g011650, Pdr9g011660, Pdr9g011670, Pdr9g011680, Pdr9g011690, Pdr9g011700, Pdr9g011710, Pdr9g011720, Pdr9g011730, Pdr9g011740, Pdr9g011750, Pdr9g011760, Pdr9g011770, Pdr9g011780, Pdr9g011790	-	-
Cluster 41	contig1145	Alkaloid	62908	151075	88.17	Aminotran_1_2, Cu_amine_oxid, p450	3	Pdr0g006830, Pdr0g006840, Pdr0g006850, Pdr0g006860, Pdr0g006870, Pdr0g006880, Pdr0g006890, Pdr0g006900, Pdr0g006910, Pdr0g006920, Pdr0g006930, Pdr0g006940	-	-
Cluster 42	contig1145	Putative	398120	491797	93.68	COesterase, Transferase	5	Pdr0g007300, Pdr0g007310, Pdr0g007320, Pdr0g007330, Pdr0g007340, Pdr0g007350, Pdr0g007360, Pdr0g007370, Pdr0g007380, Pdr0g007390, Pdr0g007400, Pdr0g007410, Pdr0g007420	-	-
Cluster 43	contig1150	Putative	126675	326867	200.19	2OG-FeII_Oxy, DIOX_N	4	Pdr0g009320, Pdr0g009330, Pdr0g009340, Pdr0g009350, Pdr0g009360, Pdr0g009370, Pdr0g009380, Pdr0g009390, Pdr0g009400, Pdr0g009410, Pdr0g009420, Pdr0g009430, Pdr0g009440, Pdr0g009450, Pdr0g009460, Pdr0g009470, Pdr0g009480, Pdr0g009490	-	-
Cluster 44	contig1180	Putative	225008	359732	134.72	Aminotran_1_2, SE	4	Pdr0g014800, Pdr0g014810, Pdr0g014820, Pdr0g014830, Pdr0g014840, Pdr0g014850, Pdr0g014860, Pdr0g014870, Pdr0g014880, Pdr0g014890, Pdr0g014900, Pdr0g014910, Pdr0g014920	-	-
Cluster 45	contig1241	Putative	5391	222837	217.45	Aminotran_1_2, DIOX_N	4	Pdr0g031870, Pdr0g031880, Pdr0g031890, Pdr0g031900, Pdr0g031910, Pdr0g031920, Pdr0g031930, Pdr0g031940, Pdr0g031950, Pdr0g031960, Pdr0g031970, Pdr0g031980	-	-
Cluster 46	contig1241	Saccharide	348058	417891	69.83	Glycos_transf_1, Transferase	3	Pdr0g032100, Pdr0g032110, Pdr0g032120, Pdr0g032130, Pdr0g032140, Pdr0g032150	-	-

Showing 1 to 46 of 46 entries

Chr1 - Cluster 1 - Saccharide

Gene cluster description

Download cluster GenBank file

Chr1 - Gene Cluster 1. Type = saccharide. Location: 13206187 - 13260490 nt. Click on genes for more information.

Show pHMM detection rules used

plants/saccharide: (minimum(3,[cMT,nMT,oMT,adh_short,Chal_sti_synt_C,Chal_sti_synt_N,COesterase,UDPGT,Glyco_transf_28,Glycos_transf_1,Glycos_transf_2,Lycopene_cycl,NAD_binding_1,p450,SQHop_cyclase_C,SQHop_cyclase_N,Prenyltrans,Terpene_synth_C,Terpene_synth,Transferase,Aminotran_1_2,AMP-binding,DIOX_N,Dirigent,Bet_v_1,Cu_amine_oxid,Str_synth,Trp_syntA,His_biosynth,adh_short_C2,Peptidase_S10,Prenyltransf,Epimerase,2OG-FeII_Oxy,Aminotran_3,Methyltransf_2,Methyltransf_3,Methyltransf_7,PRISE,Cellulose_synt,Chalcone,ERG4_ERG24,FA_desaturase,FA_desaturase_2,Methyltransf_11,polyprenyl_synt,SE,SQS_PSY,TPMT,UbiA,Lipoxygenase,Lyase_aromatic,HMGL-like,Chalcone_3,Chalcone_2,Acetyltransf_1,UDPGT_2,GMC_oxred_N,GMC_oxred_C,Amino_oxidase,DAHP_synth_1,DAHP_synth_2], [Glycos_transf_1/Glycos_transf_2/Glycos_transf_28/UDPGT/UDPGT_2]))

Genes:

Locus tag	Functional annotation	From	To	Strand	Category	Domains
Pdr1g007110	U11/U12 small nuclear ribonucleoprotein 59 kDa protein	13208585	13211641	-	Other genes	n/a
Pdr1g007120	delta(8)-fatty-acid desaturase-like	13212828	13214170	-	Fatty acid desaturase	FA_desaturase (E=2.7e-11)
Pdr1g007130	delta(8)-fatty-acid desaturase-like	13226129	13227472	-	Fatty acid desaturase	FA_desaturase (E=3e-34)
Pdr1g007140	hypothetical protein	13233719	13235387	-	Other genes	n/a
Pdr1g007150	ribonuclease H protein	13236502	13237678	+	Other genes	n/a
Pdr1g007160	protein ABIL1-like	13239026	13241182	+	Other genes	n/a
Pdr1g007170	UDP-D-xylose:L-fucose alpha-1	13242213	13244464	+	Other genes	n/a
Pdr1g007180	hypothetical protein	13246453	13253849	+	Glycosyltransferase	Glycos_transf_1 (E=3.4e-08)
Pdr1g007190	rRNA-processing protein FCF1-like protein	13256455	13258688	-	Other genes	n/a

Show:

biosynthetic genesother genes

Legend:

Cytochrome 450

Terpene synthase

Copper amine oxidase

Pictet-Spengler enzyme (Bet v1)

Glycosyltransferase

Ketosynthase

Squalene epoxidase

COesterase

Methyltransferase

BAHD acyltransferase

Scl acyltransferase

Epimerase

Oxidoreductase

Dioxygenase

Transporter

CoA-ligase

Amino oxidase

Aminotransferase

Prenyltransferase

Strictosidine synthase-like

PRISE enzymes

Dirigent enzymes

Cellulose synthase-like

Fatty acid desaturase

Lipoxygenase

Polyprenyl synthetase

(Other) Biosynthetic Genes

Other Genes

biosynthetic genes

transport-related genes

regulatory genes

other genes

Chr1 - Cluster 2 - Lignan-polyketide

Gene cluster description

Download cluster GenBank file

Chr1 - Gene Cluster 2. Type = lignan-polyketide. Location: 16824965 - 16866175 nt. Click on genes for more information.

Show pHMM detection rules used

plants/lignan: (minimum(3,[cMT,nMT,oMT,adh_short,Chal_sti_synt_C,Chal_sti_synt_N,COesterase,UDPGT,Glyco_transf_28,Glycos_transf_1,Glycos_transf_2,Lycopene_cycl,NAD_binding_1,p450,SQHop_cyclase_C,SQHop_cyclase_N,Prenyltrans,Terpene_synth_C,Terpene_synth,Transferase,Aminotran_1_2,AMP-binding,DIOX_N,Dirigent,Bet_v_1,Cu_amine_oxid,Str_synth,Trp_syntA,His_biosynth,adh_short_C2,Peptidase_S10,Prenyltransf,Epimerase,2OG-FeII_Oxy,Aminotran_3,Methyltransf_2,Methyltransf_3,Methyltransf_7,PRISE,Cellulose_synt,Chalcone,ERG4_ERG24,FA_desaturase,FA_desaturase_2,Methyltransf_11,polyprenyl_synt,SE,SQS_PSY,TPMT,UbiA,Lipoxygenase,Lyase_aromatic,HMGL-like,Chalcone_3,Chalcone_2,Acetyltransf_1,UDPGT_2,GMC_oxred_N,GMC_oxred_C,Amino_oxidase,DAHP_synth_1,DAHP_synth_2], [Dirigent]))
plants/polyketide: (minimum(3,[cMT,nMT,oMT,adh_short,Chal_sti_synt_C,Chal_sti_synt_N,COesterase,UDPGT,Glyco_transf_28,Glycos_transf_1,Glycos_transf_2,Lycopene_cycl,NAD_binding_1,p450,SQHop_cyclase_C,SQHop_cyclase_N,Prenyltrans,Terpene_synth_C,Terpene_synth,Transferase,Aminotran_1_2,AMP-binding,DIOX_N,Dirigent,Bet_v_1,Cu_amine_oxid,Str_synth,Trp_syntA,His_biosynth,adh_short_C2,Peptidase_S10,Prenyltransf,Epimerase,2OG-FeII_Oxy,Aminotran_3,Methyltransf_2,Methyltransf_3,Methyltransf_7,PRISE,Cellulose_synt,Chalcone,ERG4_ERG24,FA_desaturase,FA_desaturase_2,Methyltransf_11,polyprenyl_synt,SE,SQS_PSY,TPMT,UbiA,Lipoxygenase,Lyase_aromatic,HMGL-like,Chalcone_3,Chalcone_2,Acetyltransf_1,UDPGT_2,GMC_oxred_N,GMC_oxred_C,Amino_oxidase,DAHP_synth_1,DAHP_synth_2], [Chal_sti_synt_C/Chal_sti_synt_N]))

Genes:

Locus tag	Functional annotation	From	To	Strand	Category	Domains
Pdr1g010970	3-ketoacyl-CoA synthase 21-like	16831478	16832905	-	Ketosynthase	Chal_sti_synt_C (E=3.9e-06)
Pdr1g010980	60S ribosomal protein L35-like	16836648	16837505	-	Other genes	n/a
Pdr1g010990	caffeoylshikimate esterase-like	16843165	16845966	+	Other genes	n/a
Pdr1g011000	splicing factor 3B subunit 3-like	16850649	16854920	-	Other genes	n/a
Pdr1g011010	dirigent protein 24-like	16856316	16857497	+	Dirigent enzymes	Dirigent (E=1.3e-32)
Pdr1g011020	dirigent protein 10-like	16858668	16859662	-	Dirigent enzymes	Dirigent (E=3.1e-31)
Pdr1g011030	hypothetical protein	16860213	16862699	-	Other genes	n/a

Show:

biosynthetic genesother genes

Legend:

Cytochrome 450

Terpene synthase

Copper amine oxidase

Pictet-Spengler enzyme (Bet v1)

Glycosyltransferase

Ketosynthase

Squalene epoxidase

COesterase

Methyltransferase

BAHD acyltransferase

Scl acyltransferase

Epimerase

Oxidoreductase

Dioxygenase

Transporter

CoA-ligase

Amino oxidase

Aminotransferase

Prenyltransferase

Strictosidine synthase-like

PRISE enzymes

Dirigent enzymes

Cellulose synthase-like

Fatty acid desaturase

Lipoxygenase

Polyprenyl synthetase

(Other) Biosynthetic Genes

Other Genes

biosynthetic genes

transport-related genes

regulatory genes

other genes

Chr10 - Cluster 3 - Terpene

Gene cluster description

Download cluster GenBank file

Chr10 - Gene Cluster 3. Type = terpene. Location: 1618665 - 1861471 nt. Click on genes for more information.

Show pHMM detection rules used

plants/plant: (minimum(4,[cMT,nMT,oMT,adh_short,Chal_sti_synt_C,Chal_sti_synt_N,COesterase,UDPGT,Glyco_transf_28,Glycos_transf_1,Glycos_transf_2,Lycopene_cycl,NAD_binding_1,p450,SQHop_cyclase_C,SQHop_cyclase_N,Prenyltrans,Terpene_synth_C,Terpene_synth,Transferase,Aminotran_1_2,AMP-binding,DIOX_N,Dirigent,Bet_v_1,Cu_amine_oxid,Str_synth,Trp_syntA,His_biosynth,adh_short_C2,Peptidase_S10,Prenyltransf,Epimerase,2OG-FeII_Oxy,Aminotran_3,Methyltransf_2,Methyltransf_3,Methyltransf_7,PRISE,Cellulose_synt,Chalcone,ERG4_ERG24,FA_desaturase,FA_desaturase_2,Methyltransf_11,polyprenyl_synt,SE,SQS_PSY,TPMT,UbiA,Lipoxygenase,Lyase_aromatic,HMGL-like,Chalcone_3,Chalcone_2,Acetyltransf_1,UDPGT_2,GMC_oxred_N,GMC_oxred_C,Amino_oxidase,DAHP_synth_1,DAHP_synth_2], []))
plants/terpene: (minimum(3,[cMT,nMT,oMT,adh_short,Chal_sti_synt_C,Chal_sti_synt_N,COesterase,UDPGT,Glyco_transf_28,Glycos_transf_1,Glycos_transf_2,Lycopene_cycl,NAD_binding_1,p450,SQHop_cyclase_C,SQHop_cyclase_N,Prenyltrans,Terpene_synth_C,Terpene_synth,Transferase,Aminotran_1_2,AMP-binding,DIOX_N,Dirigent,Bet_v_1,Cu_amine_oxid,Str_synth,Trp_syntA,His_biosynth,adh_short_C2,Peptidase_S10,Prenyltransf,Epimerase,2OG-FeII_Oxy,Aminotran_3,Methyltransf_2,Methyltransf_3,Methyltransf_7,PRISE,Cellulose_synt,Chalcone,ERG4_ERG24,FA_desaturase,FA_desaturase_2,Methyltransf_11,polyprenyl_synt,SE,SQS_PSY,TPMT,UbiA,Lipoxygenase,Lyase_aromatic,HMGL-like,Chalcone_3,Chalcone_2,Acetyltransf_1,UDPGT_2,GMC_oxred_N,GMC_oxred_C,Amino_oxidase,DAHP_synth_1,DAHP_synth_2], [Terpene_synth/Terpene_synth_C/Prenyltrans/SQHop_cyclase_C/SQHop_cyclase_N/PRISE]))

Genes:

Locus tag	Functional annotation	From	To	Strand	Category	Domains
Pdr10g002280	F-box protein	1616094	1619059	-	Other genes	n/a
Pdr10g002290	mediator-associated protein 1-like	1620754	1622424	+	Other genes	n/a
Pdr10g002300	hypothetical protein	1623626	1624141	+	Other genes	n/a
Pdr10g002310	hypothetical protein	1624527	1625530	-	Other genes	n/a
Pdr10g002320	hypothetical protein	1626794	1628803	+	Other genes	n/a
Pdr10g002330	anthocyanidin reductase	1632193	1634886	+	Epimerase	Epimerase (E=2e-16)
Pdr10g002340	hypothetical protein	1669304	1669989	-	Other genes	n/a
Pdr10g002350	farnesene synthase	1672834	1676264	+	Terpene synthase	Terpene_synth_C (E=6.9e-34), Terpene_synth (E=5.7e-24)
Pdr10g002360	farnesene synthase	1684275	1687664	+	Terpene synthase	Terpene_synth_C (E=7.4e-34), Terpene_synth (E=5.4e-23)
Pdr10g002370	alpha-farnesene synthase	1696768	1700225	+	Terpene synthase	Terpene_synth_C (E=7.5e-47), Terpene_synth (E=5.9e-24)
Pdr10g002380	hypothetical protein	1705813	1709138	+	Other genes	n/a
Pdr10g002390	intracellular protein transport protein USO1	1710788	1715325	+	Other genes	n/a
Pdr10g002400	(3S-6E)-nerolidol synthase 1-like	1724676	1753057	+	Terpene synthase	Terpene_synth_C (E=5.3e-27), Terpene_synth (E=9.5e-19)
Pdr10g002410	pentatricopeptide repeat-containing protein	1753411	1754487	-	Other genes	n/a
Pdr10g002420	hypothetical protein	1758655	1765941	-	Other genes	n/a
Pdr10g002430	(3S-6E)-nerolidol synthase 1-like	1771912	1774376	+	Terpene synthase	Terpene_synth_C (E=1.8e-33), Terpene_synth (E=3.2e-23)
Pdr10g002440	(3S-6E)-nerolidol synthase 1-like	1785206	1785556	+	Terpene synthase	Terpene_synth_C (E=9.9e-14)
Pdr10g002450	(3S-6E)-nerolidol synthase 1-like	1831296	1831648	+	Terpene synthase	Terpene_synth_C (E=2.1e-12)
Pdr10g002460	pentatricopeptide repeat-containing protein	1832578	1833348	-	Other genes	n/a
Pdr10g002470	transcription factor DYSFUNCTIONAL TAPETUM 1-like	1842276	1847943	+	Terpene synthase	Terpene_synth (E=8.6e-20)
Pdr10g002480	hypothetical protein	1848577	1849555	-	Other genes	n/a
Pdr10g002490	hypothetical protein	1851045	1851896	-	Other genes	n/a

Show:

biosynthetic genesother genes

Legend:

Cytochrome 450

Terpene synthase

Copper amine oxidase

Pictet-Spengler enzyme (Bet v1)

Glycosyltransferase

Ketosynthase

Squalene epoxidase

COesterase

Methyltransferase

BAHD acyltransferase

Scl acyltransferase

Epimerase

Oxidoreductase

Dioxygenase

Transporter

CoA-ligase

Amino oxidase

Aminotransferase

Prenyltransferase

Strictosidine synthase-like

PRISE enzymes

Dirigent enzymes

Cellulose synthase-like

Fatty acid desaturase

Lipoxygenase

Polyprenyl synthetase

(Other) Biosynthetic Genes

Other Genes

biosynthetic genes

transport-related genes

regulatory genes

other genes

Chr10 - Cluster 4 - Cyclopeptide

Gene cluster description

Download cluster GenBank file

Chr10 - Gene Cluster 4. Type = cyclopeptide. Location: 22973483 - 23785221 nt. Click on genes for more information.

Show pHMM detection rules used

plants/cyclopeptide: (BURP)

Genes:

Locus tag	Functional annotation	From	To	Strand	Category	Domains
Pdr10g022260	ribonuclease H protein	22986414	22988155	-	Other genes	n/a
Pdr10g022270	glucan endo-1	22990325	22990762	-	Other genes	n/a
Pdr10g022280	polyol transporter 1	22997364	23000305	+	Other genes	n/a
Pdr10g022290	polyol transporter 1	23024078	23026833	+	Other genes	n/a
Pdr10g022300	hypothetical protein	23050873	23051166	-	Other genes	n/a
Pdr10g022310	GDP-L-fucose synthase 2	23052933	23055397	+	Other genes	n/a
Pdr10g022320	sorbitol transporter	23078950	23081934	+	Other genes	n/a
Pdr10g022330	SPT2-like protein	23087127	23089181	+	Other genes	n/a
Pdr10g022340	polyol transporter 1	23098260	23100434	+	Other genes	n/a
Pdr10g022350	hypothetical protein	23115023	23115265	-	Other genes	n/a
Pdr10g022360	FRIGIDA-like protein 4a	23117084	23117260	+	Other genes	n/a
Pdr10g022370	polyol transporter 5-like	23156267	23158763	+	Other genes	n/a
Pdr10g022380	calreticulin	23160826	23161408	-	Other genes	n/a
Pdr10g022390	hypothetical protein	23170841	23171313	-	Other genes	n/a
Pdr10g022400	polyol transporter 1	23185113	23187766	+	Other genes	n/a
Pdr10g022410	delta(7)-sterol-C5(6)-desaturase-like	23196067	23198852	+	Other genes	n/a
Pdr10g022420	polyol transporter 1	23200564	23202815	+	Other genes	n/a
Pdr10g022430	polyol transporter 1	23227409	23229179	+	Other genes	n/a
Pdr10g022440	nogo-B receptor	23230865	23233634	-	Other genes	n/a
Pdr10g022450	mediator of RNA polymerase II transcription subunit 32-like	23239456	23239890	-	Other genes	n/a
Pdr10g022460	adenylate kinase isoenzyme 6-like protein	23244604	23245225	-	Other genes	n/a
Pdr10g022470	DNA-directed RNA polymerases I and III subunit RPAC2-like	23246725	23248129	+	Other genes	n/a
Pdr10g022480	hypothetical protein	23252206	23253165	-	Other genes	n/a
Pdr10g022490	hypothetical protein	23255248	23255538	-	Other genes	n/a
Pdr10g022500	hypothetical protein	23295683	23296447	+	Other genes	n/a
Pdr10g022510	phosphatidylinositol 4-kinase alpha 1-like	23297399	23317537	+	Other genes	n/a
Pdr10g022520	organ-specific protein P4-like	23356282	23356809	+	Other genes	n/a
Pdr10g022530	BURP domain-containing protein 3-like	23360244	23361262	-	(Other) biosynthetic genes	BURP (E=4.2e-79)
Pdr10g022540	BURP domain-containing protein 3-like	23397445	23398460	-	(Other) biosynthetic genes	BURP (E=5.4e-80)
Pdr10g022550	organ-specific protein P4-like	23401896	23402575	+	Other genes	n/a
Pdr10g022560	organ-specific protein P4-like	23414851	23415759	+	Other genes	n/a
Pdr10g022570	cucumisin-like	23441710	23448564	+	Other genes	n/a
Pdr10g022580	zinc finger MYM-type protein 1-like	23462372	23463750	+	Other genes	n/a
Pdr10g022590	SWI/SNF complex subunit SWI3D	23471816	23476660	+	Other genes	n/a
Pdr10g022600	ras-related protein Rab7-like	23479335	23482078	-	Other genes	n/a
Pdr10g022610	proline-rich receptor-like protein kinase PERK6	23511037	23515090	+	Other genes	n/a
Pdr10g022620	coatomer subunit gamma	23518103	23523612	-	Other genes	n/a
Pdr10g022630	guanine nucleotide-binding protein subunit beta	23525217	23529424	-	Other genes	n/a
Pdr10g022640	glucan endo-1	23534139	23537982	-	Other genes	n/a
Pdr10g022650	cyclase-associated protein 1-like	23542731	23547056	-	Other genes	n/a
Pdr10g022660	receptor-like serine/threonine-protein kinase	23559969	23564069	+	Other genes	n/a
Pdr10g022670	hypothetical protein	23588133	23590032	-	Other genes	n/a
Pdr10g022680	hypothetical protein	23593903	23594732	-	Other genes	n/a
Pdr10g022690	NADH dehydrogenase [ubiquinone] iron-sulfur protein 8	23595103	23598361	+	Other genes	n/a
Pdr10g022700	F-box protein	23601855	23604334	+	Other genes	n/a
Pdr10g022710	histone deacetylase 5-like	23604400	23605728	+	Other genes	n/a
Pdr10g022720	phenylalanine--tRNA ligase alpha subunit	23620337	23627847	+	Other genes	n/a
Pdr10g022730	50S ribosomal protein L27	23635448	23635894	+	Other genes	n/a
Pdr10g022740	hypothetical protein	23639005	23642977	-	Other genes	n/a
Pdr10g022750	LRR receptor-like serine/threonine-protein kinase	23647581	23652875	-	Other genes	n/a
Pdr10g022760	hypothetical protein	23669461	23670054	+	Other genes	n/a
Pdr10g022770	hypothetical protein	23670684	23671037	+	Other genes	n/a
Pdr10g022780	hypothetical protein	23671739	23672185	+	Other genes	n/a
Pdr10g022790	E3 ubiquitin-protein ligase ATL4	23699809	23700072	+	Other genes	n/a
Pdr10g022800	glucan endo-1	23706798	23710743	-	Other genes	n/a
Pdr10g022810	glycine-rich RNA-binding protein 1	23725960	23726917	+	Other genes	n/a
Pdr10g022820	receptor-like protein kinase 5	23739187	23739474	+	Other genes	n/a
Pdr10g022830	hypothetical protein	23775895	23776206	-	Other genes	n/a

Show:

biosynthetic genesother genes

Legend:

Cytochrome 450

Terpene synthase

Copper amine oxidase

Pictet-Spengler enzyme (Bet v1)

Glycosyltransferase

Ketosynthase

Squalene epoxidase

COesterase

Methyltransferase

BAHD acyltransferase

Scl acyltransferase

Epimerase

Oxidoreductase

Dioxygenase

Transporter

CoA-ligase

Amino oxidase

Aminotransferase

Prenyltransferase

Strictosidine synthase-like

PRISE enzymes

Dirigent enzymes

Cellulose synthase-like

Fatty acid desaturase

Lipoxygenase

Polyprenyl synthetase

(Other) Biosynthetic Genes

Other Genes

biosynthetic genes

transport-related genes

regulatory genes

other genes

The following known motifs were found in CDS Pdr10g022560
Location between 23414850 and 23415759
FEPR was found 2 times in this sequence
Sequence:
MKSLCATLALFSLLLFAKTIESRGGVGEYWKTVMNEQSMPQAIGGLLGDVPDSTPKKKADDCH
ENMKKPFVGTEEFEPRPNVSSYHDGESKAENSTKDTDSLPKSQAFHDKKSFVAKEEKQSSFDED
FEPRPNVSVYNE

The following known motifs were found in CDS Pdr10g022550
Location between 23401895 and 23402575
FEPR was found 2 times in this sequence
Sequence:
MWCHVTERTSLIIILVRVSLSLLDQFAKTIESRGGVGEYWKTVMNEQSMPQAIGGLLGVVPDS
TQKKKADDCHENMKKPFVGTEEFEPRPNNSTKATDSLPKSQAYPDKKSFVAKEEKQSSFDEDFE
PRPDKDIGPERSGFMTVRYVWFGVYVSS

Chr11 - Cluster 5 - Putative

Gene cluster description

Download cluster GenBank file

Chr11 - Gene Cluster 5. Type = putative. Location: 2917673 - 3099809 nt. Click on genes for more information.

Show pHMM detection rules used

plants/plant: (minimum(4,[cMT,nMT,oMT,adh_short,Chal_sti_synt_C,Chal_sti_synt_N,COesterase,UDPGT,Glyco_transf_28,Glycos_transf_1,Glycos_transf_2,Lycopene_cycl,NAD_binding_1,p450,SQHop_cyclase_C,SQHop_cyclase_N,Prenyltrans,Terpene_synth_C,Terpene_synth,Transferase,Aminotran_1_2,AMP-binding,DIOX_N,Dirigent,Bet_v_1,Cu_amine_oxid,Str_synth,Trp_syntA,His_biosynth,adh_short_C2,Peptidase_S10,Prenyltransf,Epimerase,2OG-FeII_Oxy,Aminotran_3,Methyltransf_2,Methyltransf_3,Methyltransf_7,PRISE,Cellulose_synt,Chalcone,ERG4_ERG24,FA_desaturase,FA_desaturase_2,Methyltransf_11,polyprenyl_synt,SE,SQS_PSY,TPMT,UbiA,Lipoxygenase,Lyase_aromatic,HMGL-like,Chalcone_3,Chalcone_2,Acetyltransf_1,UDPGT_2,GMC_oxred_N,GMC_oxred_C,Amino_oxidase,DAHP_synth_1,DAHP_synth_2], []))

Genes:

Locus tag	Functional annotation	From	To	Strand	Category	Domains
Pdr11g003910	C2 domain-containing protein	2917130	2922452	-	Other genes	n/a
Pdr11g003920	BAHD acyltransferase	2931262	2932552	+	BAHD acyltransferase	Transferase (E=2e-24)
Pdr11g003930	C2 domain-containing protein	2935623	2940914	-	Other genes	n/a
Pdr11g003940	zinc finger protein JAGGED-like	2943862	2944059	-	Other genes	n/a
Pdr11g003950	60S ribosomal protein L18a-like protein	2949568	2951358	+	Other genes	n/a
Pdr11g003960	2-oxoglutarate-dependent dioxygenase AOP1	2975089	2975704	-	Dioxygenase	2OG-FeII_Oxy (E=4.4e-12)
Pdr11g003970	polycomb group protein EMBRYONIC FLOWER 2-like	3004930	3013130	+	Other genes	n/a
Pdr11g003980	cytochrome P450 CYP72A219-like	3014457	3016618	+	Cytochrome 450	p450 (E=1e-36)
Pdr11g003990	aarF domain-containing protein kinase 4-like	3023216	3024016	+	Other genes	n/a
Pdr11g004000	cytochrome P450 CYP72A219-like	3039474	3041617	+	Cytochrome 450	p450 (E=3.1e-36)
Pdr11g004010	cytochrome P450 CYP72A219-like	3049369	3052367	+	Cytochrome 450	p450 (E=5.5e-37)
Pdr11g004020	cytochrome P450 CYP72A219-like	3057295	3060344	+	Cytochrome 450	p450 (E=2.1e-34)
Pdr11g004030	cytochrome P450 CYP72A219-like	3073717	3075262	+	Cytochrome 450	p450 (E=4.7e-37)
Pdr11g004040	mitochondrial inner membrane protease subunit 1	3079246	3081897	-	Other genes	n/a
Pdr11g004050	solanesyl-diphosphate synthase 3	3082913	3086220	-	Polyprenyl synthetase	polyprenyl_synt (E=1.3e-33)
Pdr11g004060	glucan endo-1	3092483	3093385	-	Other genes	n/a
Pdr11g004070	fatty-acid-binding protein 3-like	3094239	3096489	+	Other genes	n/a
Pdr11g004080	receptor-like serine/threonine-protein kinase	3098325	3099879	-	Other genes	n/a

Show:

biosynthetic genesother genes

Legend:

Cytochrome 450

Terpene synthase

Copper amine oxidase

Pictet-Spengler enzyme (Bet v1)

Glycosyltransferase

Ketosynthase

Squalene epoxidase

COesterase

Methyltransferase

BAHD acyltransferase

Scl acyltransferase

Epimerase

Oxidoreductase

Dioxygenase

Transporter

CoA-ligase

Amino oxidase

Aminotransferase

Prenyltransferase

Strictosidine synthase-like

PRISE enzymes

Dirigent enzymes

Cellulose synthase-like

Fatty acid desaturase

Lipoxygenase

Polyprenyl synthetase

(Other) Biosynthetic Genes

Other Genes

biosynthetic genes

transport-related genes

regulatory genes

other genes

Chr11 - Cluster 6 - Terpene

Gene cluster description

Download cluster GenBank file

Chr11 - Gene Cluster 6. Type = terpene. Location: 6464068 - 6540725 nt. Click on genes for more information.

Show pHMM detection rules used

plants/plant: (minimum(4,[cMT,nMT,oMT,adh_short,Chal_sti_synt_C,Chal_sti_synt_N,COesterase,UDPGT,Glyco_transf_28,Glycos_transf_1,Glycos_transf_2,Lycopene_cycl,NAD_binding_1,p450,SQHop_cyclase_C,SQHop_cyclase_N,Prenyltrans,Terpene_synth_C,Terpene_synth,Transferase,Aminotran_1_2,AMP-binding,DIOX_N,Dirigent,Bet_v_1,Cu_amine_oxid,Str_synth,Trp_syntA,His_biosynth,adh_short_C2,Peptidase_S10,Prenyltransf,Epimerase,2OG-FeII_Oxy,Aminotran_3,Methyltransf_2,Methyltransf_3,Methyltransf_7,PRISE,Cellulose_synt,Chalcone,ERG4_ERG24,FA_desaturase,FA_desaturase_2,Methyltransf_11,polyprenyl_synt,SE,SQS_PSY,TPMT,UbiA,Lipoxygenase,Lyase_aromatic,HMGL-like,Chalcone_3,Chalcone_2,Acetyltransf_1,UDPGT_2,GMC_oxred_N,GMC_oxred_C,Amino_oxidase,DAHP_synth_1,DAHP_synth_2], []))
plants/terpene: (minimum(3,[cMT,nMT,oMT,adh_short,Chal_sti_synt_C,Chal_sti_synt_N,COesterase,UDPGT,Glyco_transf_28,Glycos_transf_1,Glycos_transf_2,Lycopene_cycl,NAD_binding_1,p450,SQHop_cyclase_C,SQHop_cyclase_N,Prenyltrans,Terpene_synth_C,Terpene_synth,Transferase,Aminotran_1_2,AMP-binding,DIOX_N,Dirigent,Bet_v_1,Cu_amine_oxid,Str_synth,Trp_syntA,His_biosynth,adh_short_C2,Peptidase_S10,Prenyltransf,Epimerase,2OG-FeII_Oxy,Aminotran_3,Methyltransf_2,Methyltransf_3,Methyltransf_7,PRISE,Cellulose_synt,Chalcone,ERG4_ERG24,FA_desaturase,FA_desaturase_2,Methyltransf_11,polyprenyl_synt,SE,SQS_PSY,TPMT,UbiA,Lipoxygenase,Lyase_aromatic,HMGL-like,Chalcone_3,Chalcone_2,Acetyltransf_1,UDPGT_2,GMC_oxred_N,GMC_oxred_C,Amino_oxidase,DAHP_synth_1,DAHP_synth_2], [Terpene_synth/Terpene_synth_C/Prenyltrans/SQHop_cyclase_C/SQHop_cyclase_N/PRISE]))

Genes:

Locus tag	Functional annotation	From	To	Strand	Category	Domains
Pdr11g007330	myosin-2	6458512	6466887	+	Other genes	n/a
Pdr11g007340	hypothetical protein	6469040	6471642	-	Other genes	n/a
Pdr11g007350	cytochrome P450 71A25-like	6473404	6478441	-	Cytochrome 450	p450 (E=1e-15)
Pdr11g007360	hypothetical protein	6489063	6489284	-	Other genes	n/a
Pdr11g007370	terpene synthase	6496241	6496955	+	Other genes	n/a
Pdr11g007380	eukaryotic translation initiation factor	6499843	6500643	-	Other genes	n/a
Pdr11g007390	hypothetical protein	6501920	6504838	+	Other genes	n/a
Pdr11g007400	hypothetical protein	6506475	6506795	+	Other genes	n/a
Pdr11g007410	hypothetical protein	6506885	6508535	-	Other genes	n/a
Pdr11g007420	(-)-germacrene D synthase-like	6517364	6518254	-	Terpene synthase	Terpene_synth_C (E=2.9e-35)
Pdr11g007430	(-)-germacrene D synthase-like	6519851	6520297	-	Terpene synthase	Terpene_synth (E=1.7e-10)
Pdr11g007440	hypothetical protein	6523801	6524017	+	Other genes	n/a
Pdr11g007450	(-)-alpha-pinene synthase-like	6528593	6531389	+	Terpene synthase	Terpene_synth_C (E=1.2e-42), Terpene_synth (E=1.6e-29)
Pdr11g007460	hypothetical protein	6536117	6547825	-	Other genes	n/a

Show:

biosynthetic genesother genes

Legend:

Cytochrome 450

Terpene synthase

Copper amine oxidase

Pictet-Spengler enzyme (Bet v1)

Glycosyltransferase

Ketosynthase

Squalene epoxidase

COesterase

Methyltransferase

BAHD acyltransferase

Scl acyltransferase

Epimerase

Oxidoreductase

Dioxygenase

Transporter

CoA-ligase

Amino oxidase

Aminotransferase

Prenyltransferase

Strictosidine synthase-like

PRISE enzymes

Dirigent enzymes

Cellulose synthase-like

Fatty acid desaturase

Lipoxygenase

Polyprenyl synthetase

(Other) Biosynthetic Genes

Other Genes

biosynthetic genes

transport-related genes

regulatory genes

other genes

Chr11 - Cluster 7 - Lignan-polyketide

Gene cluster description

Download cluster GenBank file

Chr11 - Gene Cluster 7. Type = lignan-polyketide. Location: 22929785 - 23044112 nt. Click on genes for more information.

Show pHMM detection rules used

plants/lignan: (minimum(3,[cMT,nMT,oMT,adh_short,Chal_sti_synt_C,Chal_sti_synt_N,COesterase,UDPGT,Glyco_transf_28,Glycos_transf_1,Glycos_transf_2,Lycopene_cycl,NAD_binding_1,p450,SQHop_cyclase_C,SQHop_cyclase_N,Prenyltrans,Terpene_synth_C,Terpene_synth,Transferase,Aminotran_1_2,AMP-binding,DIOX_N,Dirigent,Bet_v_1,Cu_amine_oxid,Str_synth,Trp_syntA,His_biosynth,adh_short_C2,Peptidase_S10,Prenyltransf,Epimerase,2OG-FeII_Oxy,Aminotran_3,Methyltransf_2,Methyltransf_3,Methyltransf_7,PRISE,Cellulose_synt,Chalcone,ERG4_ERG24,FA_desaturase,FA_desaturase_2,Methyltransf_11,polyprenyl_synt,SE,SQS_PSY,TPMT,UbiA,Lipoxygenase,Lyase_aromatic,HMGL-like,Chalcone_3,Chalcone_2,Acetyltransf_1,UDPGT_2,GMC_oxred_N,GMC_oxred_C,Amino_oxidase,DAHP_synth_1,DAHP_synth_2], [Dirigent]))
plants/polyketide: (minimum(3,[cMT,nMT,oMT,adh_short,Chal_sti_synt_C,Chal_sti_synt_N,COesterase,UDPGT,Glyco_transf_28,Glycos_transf_1,Glycos_transf_2,Lycopene_cycl,NAD_binding_1,p450,SQHop_cyclase_C,SQHop_cyclase_N,Prenyltrans,Terpene_synth_C,Terpene_synth,Transferase,Aminotran_1_2,AMP-binding,DIOX_N,Dirigent,Bet_v_1,Cu_amine_oxid,Str_synth,Trp_syntA,His_biosynth,adh_short_C2,Peptidase_S10,Prenyltransf,Epimerase,2OG-FeII_Oxy,Aminotran_3,Methyltransf_2,Methyltransf_3,Methyltransf_7,PRISE,Cellulose_synt,Chalcone,ERG4_ERG24,FA_desaturase,FA_desaturase_2,Methyltransf_11,polyprenyl_synt,SE,SQS_PSY,TPMT,UbiA,Lipoxygenase,Lyase_aromatic,HMGL-like,Chalcone_3,Chalcone_2,Acetyltransf_1,UDPGT_2,GMC_oxred_N,GMC_oxred_C,Amino_oxidase,DAHP_synth_1,DAHP_synth_2], [Chal_sti_synt_C/Chal_sti_synt_N]))

Genes:

Locus tag	Functional annotation	From	To	Strand	Category	Domains
Pdr11g017930	nudix hydrolase 9	22933566	22936859	-	Other genes	n/a
Pdr11g017940	3-ketoacyl-CoA synthase 12-like	22945422	22946837	-	Ketosynthase	Chal_sti_synt_C (E=6e-09)
Pdr11g017950	S2-RNase	22954636	22954800	-	Other genes	n/a
Pdr11g017960	exocyst complex component EXO70B1-like	22974274	22976171	-	Other genes	n/a
Pdr11g017970	60S ribosomal protein L35-like	23000518	23002158	-	Other genes	n/a
Pdr11g017980	proline-rich receptor-like protein kinase PERK8	23007854	23009215	+	Other genes	n/a
Pdr11g017990	dirigent protein 10-like	23021536	23022468	-	Dirigent enzymes	Dirigent (E=9.2e-31)
Pdr11g018000	pentatricopeptide repeat-containing protein	23024272	23026068	+	Other genes	n/a
Pdr11g018010	licodione synthase-like	23028134	23028475	-	Cytochrome 450	p450 (E=3.7e-13)

Show:

biosynthetic genesother genes

Legend:

Cytochrome 450

Terpene synthase

Copper amine oxidase

Pictet-Spengler enzyme (Bet v1)

Glycosyltransferase

Ketosynthase

Squalene epoxidase

COesterase

Methyltransferase

BAHD acyltransferase

Scl acyltransferase

Epimerase

Oxidoreductase

Dioxygenase

Transporter

CoA-ligase

Amino oxidase

Aminotransferase

Prenyltransferase

Strictosidine synthase-like

PRISE enzymes

Dirigent enzymes

Cellulose synthase-like

Fatty acid desaturase

Lipoxygenase

Polyprenyl synthetase

(Other) Biosynthetic Genes

Other Genes

biosynthetic genes

transport-related genes

regulatory genes

other genes

Chr12 - Cluster 8 - Saccharide

Gene cluster description

Download cluster GenBank file

Chr12 - Gene Cluster 8. Type = saccharide. Location: 21027445 - 21100190 nt. Click on genes for more information.

Show pHMM detection rules used

plants/saccharide: (minimum(3,[cMT,nMT,oMT,adh_short,Chal_sti_synt_C,Chal_sti_synt_N,COesterase,UDPGT,Glyco_transf_28,Glycos_transf_1,Glycos_transf_2,Lycopene_cycl,NAD_binding_1,p450,SQHop_cyclase_C,SQHop_cyclase_N,Prenyltrans,Terpene_synth_C,Terpene_synth,Transferase,Aminotran_1_2,AMP-binding,DIOX_N,Dirigent,Bet_v_1,Cu_amine_oxid,Str_synth,Trp_syntA,His_biosynth,adh_short_C2,Peptidase_S10,Prenyltransf,Epimerase,2OG-FeII_Oxy,Aminotran_3,Methyltransf_2,Methyltransf_3,Methyltransf_7,PRISE,Cellulose_synt,Chalcone,ERG4_ERG24,FA_desaturase,FA_desaturase_2,Methyltransf_11,polyprenyl_synt,SE,SQS_PSY,TPMT,UbiA,Lipoxygenase,Lyase_aromatic,HMGL-like,Chalcone_3,Chalcone_2,Acetyltransf_1,UDPGT_2,GMC_oxred_N,GMC_oxred_C,Amino_oxidase,DAHP_synth_1,DAHP_synth_2], [Glycos_transf_1/Glycos_transf_2/Glycos_transf_28/UDPGT/UDPGT_2]))

Genes:

Locus tag	Functional annotation	From	To	Strand	Category	Domains
Pdr12g018440	delta(14)-sterol reductase-like	21035428	21040148	-	(Other) biosynthetic genes	ERG4_ERG24 (E=9.5e-11)
Pdr12g018450	tocopherol O-methyltransferase	21045450	21053800	+	Methyltransferase	Methyltransf_11 (E=1.4e-09)
Pdr12g018460	hypothetical protein	21055937	21056707	+	Other genes	n/a
Pdr12g018470	histone deacetylase HDT1-like	21057791	21061897	+	Other genes	n/a
Pdr12g018480	splicing factor U2af small subunit B-like	21064361	21066997	-	Other genes	n/a
Pdr12g018490	enolase	21068198	21071505	-	Other genes	n/a
Pdr12g018500	peroxiredoxin-2E-2	21076982	21077683	+	Other genes	n/a
Pdr12g018510	pentatricopeptide repeat-containing protein	21079519	21082080	-	Other genes	n/a
Pdr12g018520	glucomannan 4-beta-mannosyltransferase 9-like	21087356	21092207	-	Glycosyltransferase	Glycos_transf_2 (E=1.2e-12)

Show:

biosynthetic genesother genes

Legend:

Cytochrome 450

Terpene synthase

Copper amine oxidase

Pictet-Spengler enzyme (Bet v1)

Glycosyltransferase

Ketosynthase

Squalene epoxidase

COesterase

Methyltransferase

BAHD acyltransferase

Scl acyltransferase

Epimerase

Oxidoreductase

Dioxygenase

Transporter

CoA-ligase

Amino oxidase

Aminotransferase

Prenyltransferase

Strictosidine synthase-like

PRISE enzymes

Dirigent enzymes

Cellulose synthase-like

Fatty acid desaturase

Lipoxygenase

Polyprenyl synthetase

(Other) Biosynthetic Genes

Other Genes

biosynthetic genes

transport-related genes

regulatory genes

other genes

Chr14 - Cluster 9 - Cyclopeptide

Gene cluster description

Download cluster GenBank file

Chr14 - Gene Cluster 9. Type = cyclopeptide. Location: 1179647 - 1563081 nt. Click on genes for more information.

Show pHMM detection rules used

plants/cyclopeptide: (BURP)

Genes:

Locus tag	Functional annotation	From	To	Strand	Category	Domains
Pdr14g001280	hypothetical protein	1186395	1187309	+	Other genes	n/a
Pdr14g001290	fructose-bisphosphate aldolase cytoplasmic isozyme	1192912	1202263	+	Other genes	n/a
Pdr14g001300	trihelix transcription factor PTL-like	1206325	1208931	-	Other genes	n/a
Pdr14g001310	ethylene-responsive transcription factor ERF024-like	1239529	1240128	+	Other genes	n/a
Pdr14g001320	hypothetical protein	1243465	1243806	-	Other genes	n/a
Pdr14g001330	hypothetical protein	1249932	1251188	-	Other genes	n/a
Pdr14g001340	dehydration-responsive element-binding protein 1B-like	1260391	1261032	-	Other genes	n/a
Pdr14g001350	hypothetical protein	1274098	1274536	+	Other genes	n/a
Pdr14g001360	histone-lysine N-methyltransferase SETD1B-like	1276618	1279508	-	Other genes	n/a
Pdr14g001370	hypothetical protein	1299292	1300979	-	Other genes	n/a
Pdr14g001380	60S ribosomal protein L15	1308373	1310078	-	Other genes	n/a
Pdr14g001390	ribonuclease H protein	1320006	1320620	-	Other genes	n/a
Pdr14g001400	growth-regulating factor 3-like	1327738	1330288	+	Other genes	n/a
Pdr14g001410	1	1332088	1340265	-	Other genes	n/a
Pdr14g001420	ABC transporter G family member 34-like	1347069	1347389	-	Other genes	n/a
Pdr14g001430	pleiotropic drug resistance protein 2-like	1347551	1349295	-	Other genes	n/a
Pdr14g001440	pleiotropic drug resistance protein 2-like	1349686	1351052	-	Other genes	n/a
Pdr14g001450	dehydration-responsive protein RD22-like	1358395	1360354	-	(Other) biosynthetic genes	BURP (E=1.9e-28)
Pdr14g001460	dehydration-responsive protein RD22-like	1371276	1373680	-	(Other) biosynthetic genes	BURP (E=1.2e-28)
Pdr14g001470	dehydration-responsive protein RD22-like	1379127	1379633	-	(Other) biosynthetic genes	BURP (E=9.9e-55)
Pdr14g001480	dehydration-responsive protein RD22-like	1383521	1384333	-	(Other) biosynthetic genes	BURP (E=3.2e-75)
Pdr14g001490	pleiotropic drug resistance protein 2-like	1388207	1394602	-	Other genes	n/a
Pdr14g001500	ABC transporter G family member 34-like	1396003	1406366	-	Other genes	n/a
Pdr14g001510	hypothetical protein	1415003	1415683	+	Other genes	n/a
Pdr14g001520	protein BUD31 1-like	1429051	1430201	-	Other genes	n/a
Pdr14g001530	hypothetical protein	1435872	1439336	-	Other genes	n/a
Pdr14g001540	serine/threonine-protein kinase D6PKL1-like	1440232	1443277	-	Other genes	n/a
Pdr14g001550	monodehydroascorbate reductase-like	1451585	1455025	+	Other genes	n/a
Pdr14g001560	60S acidic ribosomal protein P2-2-like	1456426	1457851	-	Other genes	n/a
Pdr14g001570	hypothetical protein	1465861	1467351	-	Other genes	n/a
Pdr14g001580	hypothetical protein	1486831	1488195	+	Other genes	n/a
Pdr14g001590	hypothetical protein	1488756	1496113	+	Other genes	n/a
Pdr14g001600	hypothetical protein	1523833	1526522	+	Other genes	n/a
Pdr14g001610	hypothetical protein	1532541	1533484	-	Other genes	n/a
Pdr14g001620	transcriptional activator hacA-like	1537941	1541471	+	Other genes	n/a
Pdr14g001630	xylem serine proteinase 1-like	1542092	1546058	-	Other genes	n/a

Show:

biosynthetic genesother genes

Legend:

Cytochrome 450

Terpene synthase

Copper amine oxidase

Pictet-Spengler enzyme (Bet v1)

Glycosyltransferase

Ketosynthase

Squalene epoxidase

COesterase

Methyltransferase

BAHD acyltransferase

Scl acyltransferase

Epimerase

Oxidoreductase

Dioxygenase

Transporter

CoA-ligase

Amino oxidase

Aminotransferase

Prenyltransferase

Strictosidine synthase-like

PRISE enzymes

Dirigent enzymes

Cellulose synthase-like

Fatty acid desaturase

Lipoxygenase

Polyprenyl synthetase

(Other) Biosynthetic Genes

Other Genes

biosynthetic genes

transport-related genes

regulatory genes

other genes

Chr14 - Cluster 10 - Saccharide

Gene cluster description

Download cluster GenBank file

Chr14 - Gene Cluster 10. Type = saccharide. Location: 18772270 - 18908595 nt. Click on genes for more information.

Show pHMM detection rules used

plants/saccharide: (minimum(3,[cMT,nMT,oMT,adh_short,Chal_sti_synt_C,Chal_sti_synt_N,COesterase,UDPGT,Glyco_transf_28,Glycos_transf_1,Glycos_transf_2,Lycopene_cycl,NAD_binding_1,p450,SQHop_cyclase_C,SQHop_cyclase_N,Prenyltrans,Terpene_synth_C,Terpene_synth,Transferase,Aminotran_1_2,AMP-binding,DIOX_N,Dirigent,Bet_v_1,Cu_amine_oxid,Str_synth,Trp_syntA,His_biosynth,adh_short_C2,Peptidase_S10,Prenyltransf,Epimerase,2OG-FeII_Oxy,Aminotran_3,Methyltransf_2,Methyltransf_3,Methyltransf_7,PRISE,Cellulose_synt,Chalcone,ERG4_ERG24,FA_desaturase,FA_desaturase_2,Methyltransf_11,polyprenyl_synt,SE,SQS_PSY,TPMT,UbiA,Lipoxygenase,Lyase_aromatic,HMGL-like,Chalcone_3,Chalcone_2,Acetyltransf_1,UDPGT_2,GMC_oxred_N,GMC_oxred_C,Amino_oxidase,DAHP_synth_1,DAHP_synth_2], [Glycos_transf_1/Glycos_transf_2/Glycos_transf_28/UDPGT/UDPGT_2]))

Genes:

Locus tag	Functional annotation	From	To	Strand	Category	Domains
Pdr14g012670	hypothetical protein	18772607	18776794	+	Other genes	n/a
Pdr14g012680	hypothetical protein	18777618	18778532	+	Other genes	n/a
Pdr14g012690	hydroquinone glucosyltransferase-like	18788142	18789617	+	Glycosyltransferase	UDPGT_2 (E=2.8e-69)
Pdr14g012700	cellulose synthase-like protein G3	18815509	18819570	+	Cellulose synthase-like	Cellulose_synt (E=6.9e-85)
Pdr14g012710	cellulose synthase-like protein G3	18882414	18885838	+	Cellulose synthase-like	Cellulose_synt (E=9.2e-86)
Pdr14g012720	cellulose synthase-like protein G3	18888244	18892723	+	Cellulose synthase-like	Cellulose_synt (E=5e-46)
Pdr14g012730	RING-H2 zinc finger protein RHA4a	18894559	18896715	-	Other genes	n/a
Pdr14g012740	hypothetical protein	18900082	18900324	+	Other genes	n/a

Show:

biosynthetic genesother genes

Legend:

Cytochrome 450

Terpene synthase

Copper amine oxidase

Pictet-Spengler enzyme (Bet v1)

Glycosyltransferase

Ketosynthase

Squalene epoxidase

COesterase

Methyltransferase

BAHD acyltransferase

Scl acyltransferase

Epimerase

Oxidoreductase

Dioxygenase

Transporter

CoA-ligase

Amino oxidase

Aminotransferase

Prenyltransferase

Strictosidine synthase-like

PRISE enzymes

Dirigent enzymes

Cellulose synthase-like

Fatty acid desaturase

Lipoxygenase

Polyprenyl synthetase

(Other) Biosynthetic Genes

Other Genes

biosynthetic genes

transport-related genes

regulatory genes

other genes

Chr15 - Cluster 11 - Putative

Gene cluster description

Download cluster GenBank file

Chr15 - Gene Cluster 11. Type = putative. Location: 14523970 - 14743507 nt. Click on genes for more information.

Show pHMM detection rules used

plants/plant: (minimum(4,[cMT,nMT,oMT,adh_short,Chal_sti_synt_C,Chal_sti_synt_N,COesterase,UDPGT,Glyco_transf_28,Glycos_transf_1,Glycos_transf_2,Lycopene_cycl,NAD_binding_1,p450,SQHop_cyclase_C,SQHop_cyclase_N,Prenyltrans,Terpene_synth_C,Terpene_synth,Transferase,Aminotran_1_2,AMP-binding,DIOX_N,Dirigent,Bet_v_1,Cu_amine_oxid,Str_synth,Trp_syntA,His_biosynth,adh_short_C2,Peptidase_S10,Prenyltransf,Epimerase,2OG-FeII_Oxy,Aminotran_3,Methyltransf_2,Methyltransf_3,Methyltransf_7,PRISE,Cellulose_synt,Chalcone,ERG4_ERG24,FA_desaturase,FA_desaturase_2,Methyltransf_11,polyprenyl_synt,SE,SQS_PSY,TPMT,UbiA,Lipoxygenase,Lyase_aromatic,HMGL-like,Chalcone_3,Chalcone_2,Acetyltransf_1,UDPGT_2,GMC_oxred_N,GMC_oxred_C,Amino_oxidase,DAHP_synth_1,DAHP_synth_2], []))

Genes:

Locus tag	Functional annotation	From	To	Strand	Category	Domains
Pdr15g008370	1-aminocyclopropane-1-carboxylic acid synthase	14542525	14544360	-	Aminotransferase	Aminotran_1_2 (E=1.2e-19)
Pdr15g008380	hypothetical protein	14569199	14569465	-	Other genes	n/a
Pdr15g008390	2-amino-3-ketobutyrate coenzyme A ligase	14577193	14580718	+	Aminotransferase	Aminotran_1_2 (E=1.4e-06)
Pdr15g008400	hypothetical protein	14582060	14590757	+	Other genes	n/a
Pdr15g008410	B3 domain-containing transcription factor VRN1-like	14597160	14598606	-	Other genes	n/a
Pdr15g008420	hypothetical protein	14604330	14606371	-	Other genes	n/a
Pdr15g008430	GTP-binding protein	14609525	14611840	-	Other genes	n/a
Pdr15g008440	squalene monooxygenase-like	14629246	14636168	-	Squalene epoxidase	SE (E=5.1e-107)
Pdr15g008450	hypothetical protein	14639726	14640017	+	Other genes	n/a
Pdr15g008460	DEAD-box ATP-dependent RNA helicase 16-like	14657840	14659940	-	Other genes	n/a
Pdr15g008470	inactive receptor kinase	14675498	14676340	-	Other genes	n/a
Pdr15g008480	AP2-like ethylene-responsive transcription factor ANT	14694037	14697136	-	Other genes	n/a
Pdr15g008490	NADPH-dependent 1-acyldihydroxyacetone phosphate reductase-like	14721941	14724952	-	Oxidoreductase	adh_short (E=2e-15)
Pdr15g008500	heterogeneous nuclear ribonucleoprotein 1-like	14732709	14734234	-	Other genes	n/a
Pdr15g008510	hypothetical protein	14740490	14741227	-	Other genes	n/a

Show:

biosynthetic genesother genes

Legend:

Cytochrome 450

Terpene synthase

Copper amine oxidase

Pictet-Spengler enzyme (Bet v1)

Glycosyltransferase

Ketosynthase

Squalene epoxidase

COesterase

Methyltransferase

BAHD acyltransferase

Scl acyltransferase

Epimerase

Oxidoreductase

Dioxygenase

Transporter

CoA-ligase

Amino oxidase

Aminotransferase

Prenyltransferase

Strictosidine synthase-like

PRISE enzymes

Dirigent enzymes

Cellulose synthase-like

Fatty acid desaturase

Lipoxygenase

Polyprenyl synthetase

(Other) Biosynthetic Genes

Other Genes

biosynthetic genes

transport-related genes

regulatory genes

other genes

Chr15 - Cluster 12 - Putative

Gene cluster description

Download cluster GenBank file

Chr15 - Gene Cluster 12. Type = putative. Location: 19438300 - 19536073 nt. Click on genes for more information.

Show pHMM detection rules used

plants/plant: (minimum(4,[cMT,nMT,oMT,adh_short,Chal_sti_synt_C,Chal_sti_synt_N,COesterase,UDPGT,Glyco_transf_28,Glycos_transf_1,Glycos_transf_2,Lycopene_cycl,NAD_binding_1,p450,SQHop_cyclase_C,SQHop_cyclase_N,Prenyltrans,Terpene_synth_C,Terpene_synth,Transferase,Aminotran_1_2,AMP-binding,DIOX_N,Dirigent,Bet_v_1,Cu_amine_oxid,Str_synth,Trp_syntA,His_biosynth,adh_short_C2,Peptidase_S10,Prenyltransf,Epimerase,2OG-FeII_Oxy,Aminotran_3,Methyltransf_2,Methyltransf_3,Methyltransf_7,PRISE,Cellulose_synt,Chalcone,ERG4_ERG24,FA_desaturase,FA_desaturase_2,Methyltransf_11,polyprenyl_synt,SE,SQS_PSY,TPMT,UbiA,Lipoxygenase,Lyase_aromatic,HMGL-like,Chalcone_3,Chalcone_2,Acetyltransf_1,UDPGT_2,GMC_oxred_N,GMC_oxred_C,Amino_oxidase,DAHP_synth_1,DAHP_synth_2], []))

Genes:

Locus tag	Functional annotation	From	To	Strand	Category	Domains
Pdr15g012550	hypothetical protein	19439194	19439382	-	Other genes	n/a
Pdr15g012560	hypothetical protein	19442777	19443535	+	Other genes	n/a
Pdr15g012570	salicylate carboxymethyltransferase	19451548	19453476	-	Methyltransferase	Methyltransf_7 (E=5.9e-116)
Pdr15g012580	hypothetical protein	19461347	19462094	+	Other genes	n/a
Pdr15g012590	E3 ubiquitin-protein ligase HIP1	19467507	19468212	+	Other genes	n/a
Pdr15g012600	hypothetical protein	19474860	19478404	+	Other genes	n/a
Pdr15g012610	abscisic acid 8'-hydroxylase 4-like	19479270	19482863	-	Cytochrome 450	p450 (E=1.3e-34)
Pdr15g012620	cytochrome P450 711A1-like	19495845	19498340	+	Cytochrome 450	p450 (E=1.5e-37)
Pdr15g012630	S-adenosylmethionine-dependent methyltransferase	19520769	19522825	+	Methyltransferase	Methyltransf_7 (E=1.8e-105)

Show:

biosynthetic genesother genes

Legend:

Cytochrome 450

Terpene synthase

Copper amine oxidase

Pictet-Spengler enzyme (Bet v1)

Glycosyltransferase

Ketosynthase

Squalene epoxidase

COesterase

Methyltransferase

BAHD acyltransferase

Scl acyltransferase

Epimerase

Oxidoreductase

Dioxygenase

Transporter

CoA-ligase

Amino oxidase

Aminotransferase

Prenyltransferase

Strictosidine synthase-like

PRISE enzymes

Dirigent enzymes

Cellulose synthase-like

Fatty acid desaturase

Lipoxygenase

Polyprenyl synthetase

(Other) Biosynthetic Genes

Other Genes

biosynthetic genes

transport-related genes

regulatory genes

other genes

Chr15 - Cluster 13 - Alkaloid

Gene cluster description

Download cluster GenBank file

Chr15 - Gene Cluster 13. Type = alkaloid. Location: 20686755 - 20731620 nt. Click on genes for more information.

Show pHMM detection rules used

plants/alkaloid: (minimum(3,[cMT,nMT,oMT,adh_short,Chal_sti_synt_C,Chal_sti_synt_N,COesterase,UDPGT,Glyco_transf_28,Glycos_transf_1,Glycos_transf_2,Lycopene_cycl,NAD_binding_1,p450,SQHop_cyclase_C,SQHop_cyclase_N,Prenyltrans,Terpene_synth_C,Terpene_synth,Transferase,Aminotran_1_2,AMP-binding,DIOX_N,Dirigent,Bet_v_1,Cu_amine_oxid,Str_synth,Trp_syntA,His_biosynth,adh_short_C2,Peptidase_S10,Prenyltransf,Epimerase,2OG-FeII_Oxy,Aminotran_3,Methyltransf_2,Methyltransf_3,Methyltransf_7,PRISE,Cellulose_synt,Chalcone,ERG4_ERG24,FA_desaturase,FA_desaturase_2,Methyltransf_11,polyprenyl_synt,SE,SQS_PSY,TPMT,UbiA,Lipoxygenase,Lyase_aromatic,HMGL-like,Chalcone_3,Chalcone_2,Acetyltransf_1,UDPGT_2,GMC_oxred_N,GMC_oxred_C,Amino_oxidase,DAHP_synth_1,DAHP_synth_2], [Bet_v_1/Cu_amine_oxid/Str_synth]))

Genes:

Locus tag	Functional annotation	From	To	Strand	Category	Domains
Pdr15g013820	endochitinase-like precursor	20671168	20689586	-	Other genes	n/a
Pdr15g013830	acyl-activating enzyme 1	20696457	20700644	+	CoA-ligase	AMP-binding (E=2e-68)
Pdr15g013840	protein YLS2-like	20705590	20709026	+	Strictosidine synthase-like	Str_synth (E=3.4e-29)
Pdr15g013850	protein YLS2-like	20717942	20719589	+	Strictosidine synthase-like	Str_synth (E=9e-29)
Pdr15g013860	acyl-activating enzyme 2	20719772	20721918	-	CoA-ligase	AMP-binding (E=3.9e-86)
Pdr15g013870	isocitrate dehydrogenase [NAD] regulatory subunit 3	20726513	20728895	-	Other genes	n/a

Show:

biosynthetic genesother genes

Legend:

Cytochrome 450

Terpene synthase

Copper amine oxidase

Pictet-Spengler enzyme (Bet v1)

Glycosyltransferase

Ketosynthase

Squalene epoxidase

COesterase

Methyltransferase

BAHD acyltransferase

Scl acyltransferase

Epimerase

Oxidoreductase

Dioxygenase

Transporter

CoA-ligase

Amino oxidase

Aminotransferase

Prenyltransferase

Strictosidine synthase-like

PRISE enzymes

Dirigent enzymes

Cellulose synthase-like

Fatty acid desaturase

Lipoxygenase

Polyprenyl synthetase

(Other) Biosynthetic Genes

Other Genes

biosynthetic genes

transport-related genes

regulatory genes

other genes

Chr15 - Cluster 14 - Cyclopeptide

Gene cluster description

Download cluster GenBank file

Chr15 - Gene Cluster 14. Type = cyclopeptide. Location: 21151956 - 21450430 nt. Click on genes for more information.

Show pHMM detection rules used

plants/cyclopeptide: (BURP)

Genes:

Locus tag	Functional annotation	From	To	Strand	Category	Domains
Pdr15g014390	oligomeric Golgi complex subunit 3-like	21150896	21157986	+	Other genes	n/a
Pdr15g014400	1-phosphatidylinositol-3-phosphate 5-kinase FAB1A	21159074	21174283	-	Other genes	n/a
Pdr15g014410	E3 ubiquitin-protein ligase RNF144B-like	21179676	21186879	-	Other genes	n/a
Pdr15g014420	E3 ubiquitin-protein ligase RNF217	21190236	21193584	-	Other genes	n/a
Pdr15g014430	hypothetical protein	21208778	21213491	-	Other genes	n/a
Pdr15g014440	MORC family CW-type zinc finger protein 3-like	21214766	21221520	-	Other genes	n/a
Pdr15g014450	protein RTE1--like	21223186	21224652	+	Other genes	n/a
Pdr15g014460	protein RTE1--like	21227259	21234818	+	Other genes	n/a
Pdr15g014470	beta-galactosidase 3	21236984	21241017	-	Other genes	n/a
Pdr15g014480	dimethyladenosine transferase	21258954	21260201	+	Methyltransferase	n/a
Pdr15g014490	3-epi-6-deoxocathasterone 23-monooxygenase	21261844	21269510	-	Cytochrome 450	n/a
Pdr15g014500	beta-glucosidase 42-like	21281225	21289786	-	Other genes	n/a
Pdr15g014510	dehydration-responsive protein RD22-like	21299746	21302640	+	(Other) biosynthetic genes	BURP (E=1.3e-65)
Pdr15g014520	methylthioribose-1-phosphate isomerase-like	21305671	21307880	-	Other genes	n/a
Pdr15g014530	methylthioribose-1-phosphate isomerase-like	21309018	21311597	+	Other genes	n/a
Pdr15g014540	dehydration-responsive protein RD22-like	21314524	21320830	-	Other genes	n/a
Pdr15g014550	hypothetical protein	21322796	21324961	+	Other genes	n/a
Pdr15g014560	aldehyde dehydrogenase family 7 member A1-like	21326936	21330408	-	Other genes	n/a
Pdr15g014570	cation/calcium exchanger 4-like	21332782	21334743	+	Other genes	n/a
Pdr15g014580	protein LURP-one-related 6-like	21335794	21336648	-	Other genes	n/a
Pdr15g014590	guanine nucleotide-binding protein subunit gamma 3	21345096	21347627	+	Other genes	n/a
Pdr15g014600	subtilisin-like protease	21348164	21350700	-	Other genes	n/a
Pdr15g014610	potassium channel SKOR-like	21352650	21353294	-	Other genes	n/a
Pdr15g014620	hypothetical protein	21376255	21384423	+	Other genes	n/a
Pdr15g014630	hypothetical protein	21385800	21386301	-	Other genes	n/a
Pdr15g014640	flavonoid 3'-monooxygenase-like	21392003	21393689	+	Cytochrome 450	n/a
Pdr15g014650	hypothetical protein	21416848	21417099	+	Other genes	n/a
Pdr15g014660	serine/threonine-protein kinase	21424308	21426258	-	Other genes	n/a
Pdr15g014670	thiol protease aleurain-like	21445822	21448214	+	Other genes	n/a
Pdr15g014680	pentatricopeptide repeat-containing protein	21450399	21451961	-	Other genes	n/a

Show:

biosynthetic genesother genes

Legend:

Cytochrome 450

Terpene synthase

Copper amine oxidase

Pictet-Spengler enzyme (Bet v1)

Glycosyltransferase

Ketosynthase

Squalene epoxidase

COesterase

Methyltransferase

BAHD acyltransferase

Scl acyltransferase

Epimerase

Oxidoreductase

Dioxygenase

Transporter

CoA-ligase

Amino oxidase

Aminotransferase

Prenyltransferase

Strictosidine synthase-like

PRISE enzymes

Dirigent enzymes

Cellulose synthase-like

Fatty acid desaturase

Lipoxygenase

Polyprenyl synthetase

(Other) Biosynthetic Genes

Other Genes

biosynthetic genes

transport-related genes

regulatory genes

other genes

Chr15 - Cluster 15 - Cyclopeptide

Gene cluster description

Download cluster GenBank file

Chr15 - Gene Cluster 15. Type = cyclopeptide. Location: 28295703 - 28738387 nt. Click on genes for more information.

Show pHMM detection rules used

plants/cyclopeptide: (BURP)

Genes:

Locus tag	Functional annotation	From	To	Strand	Category	Domains
Pdr15g023820	TMV resistance protein N-like	28294859	28304067	+	Other genes	n/a
Pdr15g023830	TMV resistance protein N-like	28304759	28308796	-	Other genes	n/a
Pdr15g023840	transcriptional corepressor LEUNIG	28310035	28318229	+	Other genes	n/a
Pdr15g023850	importin subunit alpha-2	28319393	28319707	+	Other genes	n/a
Pdr15g023860	proteasome subunit beta type-6	28320316	28324929	+	Other genes	n/a
Pdr15g023870	AIG2-like protein	28327951	28329091	+	Other genes	n/a
Pdr15g023880	L-arabinokinase-like	28329400	28336663	-	Other genes	n/a
Pdr15g023890	hypothetical protein	28338731	28340479	-	Other genes	n/a
Pdr15g023900	hypothetical protein	28340879	28341695	+	Other genes	n/a
Pdr15g023910	hypothetical protein	28343311	28343817	-	Other genes	n/a
Pdr15g023920	hypothetical protein	28352707	28355219	+	Other genes	n/a
Pdr15g023930	exostosin-like 3	28358548	28359576	+	Other genes	n/a
Pdr15g023940	basic leucine zipper 9-like	28372896	28375470	+	Other genes	n/a
Pdr15g023950	calmodulin-like protein 7	28376708	28377277	-	Other genes	n/a
Pdr15g023960	G-type lectin S-receptor-like serine/threonine-protein kinase	28378828	28379070	-	Other genes	n/a
Pdr15g023970	DNA-damage-repair/toleration protein DRT102	28380636	28380818	-	Other genes	n/a
Pdr15g023980	hypothetical protein	28381997	28387924	-	Other genes	n/a
Pdr15g023990	histone deacetylase 18-like	28398594	28412733	+	Other genes	n/a
Pdr15g024000	intracellular protein transport protein USO1-like	28418871	28422166	+	Other genes	n/a
Pdr15g024010	intracellular protein transport protein USO1-like	28423351	28424675	+	Other genes	n/a
Pdr15g024020	intracellular protein transport protein USO1-like	28426888	28431206	+	Other genes	n/a
Pdr15g024030	NAC domain-containing protein 100-like	28435568	28438211	-	Other genes	n/a
Pdr15g024040	tRNA (guanine-N(7)-)-methyltransferase-like	28444901	28445680	+	Other genes	n/a
Pdr15g024050	pentatricopeptide repeat-containing protein	28448290	28449918	-	Other genes	n/a
Pdr15g024060	pentatricopeptide repeat-containing protein	28449952	28452004	+	Other genes	n/a
Pdr15g024070	serine/threonine-protein kinase AFC3	28452486	28455803	-	Other genes	n/a
Pdr15g024080	two-on-two hemoglobin-3	28457181	28458371	+	Other genes	n/a
Pdr15g024090	hypothetical protein	28461709	28464911	-	Other genes	n/a
Pdr15g024100	enolase-phosphatase E1-like	28468786	28475780	-	Other genes	n/a
Pdr15g024110	helicase and polymerase-containing protein TEBICHI	28477626	28478539	+	Other genes	n/a
Pdr15g024120	helicase and polymerase-containing protein TEBICHI	28480482	28483698	+	Other genes	n/a
Pdr15g024130	aminopeptidase M1-like	28485305	28491589	-	Other genes	n/a
Pdr15g024140	dehydration-responsive protein RD22-like	28496608	28498599	-	Other genes	n/a
Pdr15g024150	BURP domain-containing protein 3-like	28516049	28518041	-	(Other) biosynthetic genes	BURP (E=2e-86)
Pdr15g024160	dehydration-responsive protein RD22-like	28538581	28540569	-	Other genes	n/a
Pdr15g024170	indole-3-pyruvate monooxygenase YUCCA6-like	28567249	28569484	+	Other genes	n/a
Pdr15g024180	60S ribosomal protein L37-3-like	28574875	28575268	+	Other genes	n/a
Pdr15g024190	GTP-binding protein	28576200	28578053	-	Other genes	n/a
Pdr15g024200	beta-adaptin-like protein A	28579008	28584693	+	Other genes	n/a
Pdr15g024210	proline-rich receptor-like protein kinase PERK15	28588121	28591385	+	Other genes	n/a
Pdr15g024220	protein SYM1-like	28591940	28593712	-	Other genes	n/a
Pdr15g024230	pentatricopeptide repeat-containing protein	28595562	28596944	+	Other genes	n/a
Pdr15g024240	presenilins-associated rhomboid-like protein	28597634	28599544	-	Other genes	n/a
Pdr15g024250	signal peptide peptidase	28601534	28605659	+	Other genes	n/a
Pdr15g024260	hypothetical protein	28612338	28615697	+	Other genes	n/a
Pdr15g024270	coiled-coil domain-containing protein 25	28617782	28619819	+	Other genes	n/a
Pdr15g024280	la protein 1	28621119	28623861	+	Other genes	n/a
Pdr15g024290	myb-related protein 3R-1-like	28626092	28630945	+	Other genes	n/a
Pdr15g024300	aspartate aminotransferase	28632296	28637966	-	Aminotransferase	n/a
Pdr15g024310	tetraspanin-19-like	28638216	28639709	-	Other genes	n/a
Pdr15g024320	hypothetical protein	28646358	28648655	-	Other genes	n/a
Pdr15g024330	vesicle-associated membrane protein 726	28649364	28649747	-	Other genes	n/a
Pdr15g024340	branched-chain-amino-acid aminotransferase-like protein 3	28652491	28654553	+	Other genes	n/a
Pdr15g024350	target of Myb protein 1	28656361	28662392	+	Other genes	n/a
Pdr15g024360	protein PEROXIN-4	28663911	28665956	+	Other genes	n/a
Pdr15g024370	protein tesmin/TSO1-like CXC 5	28668947	28673976	-	Other genes	n/a
Pdr15g024380	hypothetical protein	28682424	28682777	-	Other genes	n/a
Pdr15g024390	protein EMBRYONIC FLOWER 1	28688894	28693934	+	Other genes	n/a
Pdr15g024400	hypothetical protein	28700593	28703516	-	Other genes	n/a
Pdr15g024410	E3 ubiquitin-protein ligase PUB23	28704465	28705457	-	Other genes	n/a
Pdr15g024420	ER membrane protein complex subunit 1-like	28707827	28713271	-	Other genes	n/a
Pdr15g024430	hypothetical protein	28714194	28714550	+	Other genes	n/a
Pdr15g024440	bark storage protein A-like	28721110	28724497	+	Other genes	n/a
Pdr15g024450	bark storage protein A-like	28726073	28727967	+	Other genes	n/a
Pdr15g024460	hypothetical protein	28730430	28732556	+	Other genes	n/a
Pdr15g024470	casein kinase I-like	28734232	28738073	+	Other genes	n/a

Show:

biosynthetic genesother genes

Legend:

Cytochrome 450

Terpene synthase

Copper amine oxidase

Pictet-Spengler enzyme (Bet v1)

Glycosyltransferase

Ketosynthase

Squalene epoxidase

COesterase

Methyltransferase

BAHD acyltransferase

Scl acyltransferase

Epimerase

Oxidoreductase

Dioxygenase

Transporter

CoA-ligase

Amino oxidase

Aminotransferase

Prenyltransferase

Strictosidine synthase-like

PRISE enzymes

Dirigent enzymes

Cellulose synthase-like

Fatty acid desaturase

Lipoxygenase

Polyprenyl synthetase

(Other) Biosynthetic Genes

Other Genes

biosynthetic genes

transport-related genes

regulatory genes

other genes

Chr16 - Cluster 16 - Cyclopeptide

Gene cluster description

Download cluster GenBank file

Chr16 - Gene Cluster 16. Type = cyclopeptide. Location: 5484141 - 5800793 nt. Click on genes for more information.

Show pHMM detection rules used

plants/cyclopeptide: (BURP)

Genes:

Locus tag	Functional annotation	From	To	Strand	Category	Domains
Pdr16g007620	hypothetical protein	5484314	5489019	+	Other genes	n/a
Pdr16g007630	carotenoid cleavage dioxygenase 4	5489337	5492185	-	Other genes	n/a
Pdr16g007640	hypothetical protein	5501579	5502577	+	Other genes	n/a
Pdr16g007650	spermidine synthase 1-like	5515375	5518705	-	Other genes	n/a
Pdr16g007660	potassium transporter 12	5524770	5528947	-	Other genes	n/a
Pdr16g007670	hypothetical protein	5530991	5535057	+	Other genes	n/a
Pdr16g007680	carotenoid cleavage dioxygenase 4a	5536414	5538308	-	Other genes	n/a
Pdr16g007690	carotenoid cleavage dioxygenase 4	5538353	5538700	+	Other genes	n/a
Pdr16g007700	carotenoid cleavage dioxygenase 4	5540654	5544805	-	Other genes	n/a
Pdr16g007710	hypothetical protein	5545729	5546178	-	Other genes	n/a
Pdr16g007720	spermidine synthase	5552886	5555634	-	Other genes	n/a
Pdr16g007730	aldehyde dehydrogenase family 2 member B7	5562810	5569589	+	Other genes	n/a
Pdr16g007740	xyloglucan endotransglucosylase/hydrolase protein 33	5570722	5572170	-	Other genes	n/a
Pdr16g007750	U-box domain-containing protein 19-like	5580459	5589179	+	Other genes	n/a
Pdr16g007760	LRR receptor-like serine/threonine-protein kinase	5589492	5591867	-	Other genes	n/a
Pdr16g007770	equilibrative nucleotide transporter 1	5593342	5595081	+	Other genes	n/a
Pdr16g007780	RNA-binding protein 25-like	5595710	5598670	-	Other genes	n/a
Pdr16g007790	serine/threonine-protein kinase HT1-like	5602778	5604595	-	Other genes	n/a
Pdr16g007800	deoxynucleoside triphosphate triphosphohydrolase SAMHD1-like protein	5605251	5610583	-	Other genes	n/a
Pdr16g007810	deoxynucleoside triphosphate triphosphohydrolase SAMHD1-like protein	5612944	5615389	-	Other genes	n/a
Pdr16g007820	pre-mRNA-processing factor 17-like	5616400	5619371	-	Other genes	n/a
Pdr16g007830	hypothetical protein	5627229	5629359	-	Other genes	n/a
Pdr16g007840	hypothetical protein	5630686	5632655	-	Other genes	n/a
Pdr16g007850	polygalacturonase non-catalytic subunit JP650	5641427	5643507	-	(Other) biosynthetic genes	BURP (E=1e-63)
Pdr16g007860	hypothetical protein	5658316	5660202	-	Other genes	n/a
Pdr16g007870	2-methylene-furan-3-one reductase-like	5661129	5663323	+	Other genes	n/a
Pdr16g007880	mandelonitrile lyase 2	5665320	5675078	-	Other genes	n/a
Pdr16g007890	transcription factor WER-like	5687132	5690081	+	Other genes	n/a
Pdr16g007900	carbonic anhydrase 2-like	5692999	5700590	-	Other genes	n/a
Pdr16g007910	AMSH-like ubiquitin thioesterase 2	5710075	5712647	+	Other genes	n/a
Pdr16g007920	hypothetical protein	5714409	5715323	-	Other genes	n/a
Pdr16g007930	serine/threonine-protein kinase OSR1-like	5721821	5722415	+	Other genes	n/a
Pdr16g007940	serine/threonine-protein kinase fray2-like	5722424	5727218	+	Other genes	n/a
Pdr16g007950	inactive poly [ADP-ribose] polymerase SRO2	5728074	5729411	-	Other genes	n/a
Pdr16g007960	proline-rich receptor-like protein kinase PERK12	5732306	5735743	+	Other genes	n/a
Pdr16g007970	transcription factor bHLH90	5736433	5738402	-	Other genes	n/a
Pdr16g007980	hypothetical protein	5740793	5741558	-	Other genes	n/a
Pdr16g007990	glucan endo-1	5743024	5744774	+	Other genes	n/a
Pdr16g008000	nucleoredoxin 1	5746326	5748927	+	Other genes	n/a
Pdr16g008010	nucleoredoxin 1	5752209	5753264	+	Other genes	n/a
Pdr16g008020	nucleoredoxin 1	5754817	5757398	+	Other genes	n/a
Pdr16g008030	hypothetical protein	5760499	5762386	+	Other genes	n/a
Pdr16g008040	pantothenate kinase 1-like	5763153	5766332	-	Other genes	n/a
Pdr16g008050	hypothetical protein	5771971	5775122	+	Other genes	n/a
Pdr16g008060	galactinol synthase 1-like	5776142	5777623	-	Other genes	n/a
Pdr16g008070	ADP-ribosylation factor 2	5782910	5785088	-	Other genes	n/a
Pdr16g008080	phosphatidylinositol 3-kinase	5791905	5797472	-	Other genes	n/a
Pdr16g008090	1	5798444	5800634	-	Other genes	n/a

Show:

biosynthetic genesother genes

Legend:

Cytochrome 450

Terpene synthase

Copper amine oxidase

Pictet-Spengler enzyme (Bet v1)

Glycosyltransferase

Ketosynthase

Squalene epoxidase

COesterase

Methyltransferase

BAHD acyltransferase

Scl acyltransferase

Epimerase

Oxidoreductase

Dioxygenase

Transporter

CoA-ligase

Amino oxidase

Aminotransferase

Prenyltransferase

Strictosidine synthase-like

PRISE enzymes

Dirigent enzymes

Cellulose synthase-like

Fatty acid desaturase

Lipoxygenase

Polyprenyl synthetase

(Other) Biosynthetic Genes

Other Genes

biosynthetic genes

transport-related genes

regulatory genes

other genes

Repeat found in Pdr16g007620
Repeat occurs 3 times in a sequence of 579 amino acids
Location between 5484313 and 5489019
Coverage of 3.11 %
Instances:
LFCFGN | LFCFMI | LFCFGN |
pattern: LFCF[MG][IN]
MGPVVCHIVFASICSASSSSFGAKRDVECVGCHVCISAAMKRRMESLHRFACPAGMCGGLSAW
CISSIARIWRSRRTMNASNLWLKKEERLYSARADMAGNNLLCCPSKLRAFRCFVLCRTVLASIC
RASGNVFGMECGVEHEHCDFDTGGRERNQGVWAGDIFEQRKRVEGVYFDAHFLCLGSVCLFCFG
NVLKWIVCIVYFYDCKNRALEKKLKMQAKKRGHKVSTEVQRGENWNVALPQSKLTVVFETLWIE
PGSESMEMESNLTVKNPKLEAFGILRKALAISAKNTNFFVFAILTSLPLFCFMIYYESVLQKFM
VEISEILKQNPDDLHFYWLVPLDTARKMKDYSAGFIHLGLLYLVPLHLLELSTVILIVDLASKI
YEEERSTKTLKEMLHIPFDKTRLKGSFVTSVYVLVLSTCTLLGLIWLAATYYVVFQPVMYGLYF
SVWCWPAFTALLTIYLAWSVVWNVSLVISVLEGTHGIKAFALAIYFSSGSEWKGILLMLVFFAW
EAILRLPCIYIGCYERRTNYVGLAAQISLFCFGNVVKWVACTIYFCDCKNRAVEKKLAMKGKTS
ENCG

Chr16 - Cluster 17 - Alkaloid

Gene cluster description

Download cluster GenBank file

Chr16 - Gene Cluster 17. Type = alkaloid. Location: 11455278 - 11600386 nt. Click on genes for more information.

Show pHMM detection rules used

plants/alkaloid: (minimum(3,[cMT,nMT,oMT,adh_short,Chal_sti_synt_C,Chal_sti_synt_N,COesterase,UDPGT,Glyco_transf_28,Glycos_transf_1,Glycos_transf_2,Lycopene_cycl,NAD_binding_1,p450,SQHop_cyclase_C,SQHop_cyclase_N,Prenyltrans,Terpene_synth_C,Terpene_synth,Transferase,Aminotran_1_2,AMP-binding,DIOX_N,Dirigent,Bet_v_1,Cu_amine_oxid,Str_synth,Trp_syntA,His_biosynth,adh_short_C2,Peptidase_S10,Prenyltransf,Epimerase,2OG-FeII_Oxy,Aminotran_3,Methyltransf_2,Methyltransf_3,Methyltransf_7,PRISE,Cellulose_synt,Chalcone,ERG4_ERG24,FA_desaturase,FA_desaturase_2,Methyltransf_11,polyprenyl_synt,SE,SQS_PSY,TPMT,UbiA,Lipoxygenase,Lyase_aromatic,HMGL-like,Chalcone_3,Chalcone_2,Acetyltransf_1,UDPGT_2,GMC_oxred_N,GMC_oxred_C,Amino_oxidase,DAHP_synth_1,DAHP_synth_2], [Bet_v_1/Cu_amine_oxid/Str_synth]))

Genes:

Locus tag	Functional annotation	From	To	Strand	Category	Domains
Pdr16g014570	linoleate 9S-lipoxygenase 5	11473323	11477673	+	Lipoxygenase	Lipoxygenase (E=1.2e-56)
Pdr16g014580	photosystem I reaction center subunit II	11487522	11488163	+	Other genes	n/a
Pdr16g014590	hypothetical protein	11495646	11497777	-	Other genes	n/a
Pdr16g014600	thermospermine synthase ACAULIS5-like	11506546	11509108	-	Other genes	n/a
Pdr16g014610	exosome complex component RRP41-like	11517470	11519654	+	Other genes	n/a
Pdr16g014620	primary amine oxidase-like	11527530	11534056	+	Copper amine oxidase	Cu_amine_oxid (E=1.8e-59)
Pdr16g014630	primary amine oxidase-like	11560159	11567517	+	Copper amine oxidase	Cu_amine_oxid (E=2.1e-60)
Pdr16g014640	Primary amine oxidase	11571626	11582341	-	Copper amine oxidase	Cu_amine_oxid (E=2e-14)
Pdr16g014650	heat shock 70 kDa protein 8-like	11584233	11585942	+	Other genes	n/a
Pdr16g014660	hypothetical protein	11595114	11598042	-	Other genes	n/a
Pdr16g014670	hypothetical protein	11598634	11604323	+	Other genes	n/a

Show:

biosynthetic genesother genes

Legend:

Cytochrome 450

Terpene synthase

Copper amine oxidase

Pictet-Spengler enzyme (Bet v1)

Glycosyltransferase

Ketosynthase

Squalene epoxidase

COesterase

Methyltransferase

BAHD acyltransferase

Scl acyltransferase

Epimerase

Oxidoreductase

Dioxygenase

Transporter

CoA-ligase

Amino oxidase

Aminotransferase

Prenyltransferase

Strictosidine synthase-like

PRISE enzymes

Dirigent enzymes

Cellulose synthase-like

Fatty acid desaturase

Lipoxygenase

Polyprenyl synthetase

(Other) Biosynthetic Genes

Other Genes

biosynthetic genes

transport-related genes

regulatory genes

other genes

Chr17 - Cluster 18 - Terpene

Gene cluster description

Download cluster GenBank file

Chr17 - Gene Cluster 18. Type = terpene. Location: 4324206 - 4469419 nt. Click on genes for more information.

Show pHMM detection rules used

plants/terpene: (minimum(3,[cMT,nMT,oMT,adh_short,Chal_sti_synt_C,Chal_sti_synt_N,COesterase,UDPGT,Glyco_transf_28,Glycos_transf_1,Glycos_transf_2,Lycopene_cycl,NAD_binding_1,p450,SQHop_cyclase_C,SQHop_cyclase_N,Prenyltrans,Terpene_synth_C,Terpene_synth,Transferase,Aminotran_1_2,AMP-binding,DIOX_N,Dirigent,Bet_v_1,Cu_amine_oxid,Str_synth,Trp_syntA,His_biosynth,adh_short_C2,Peptidase_S10,Prenyltransf,Epimerase,2OG-FeII_Oxy,Aminotran_3,Methyltransf_2,Methyltransf_3,Methyltransf_7,PRISE,Cellulose_synt,Chalcone,ERG4_ERG24,FA_desaturase,FA_desaturase_2,Methyltransf_11,polyprenyl_synt,SE,SQS_PSY,TPMT,UbiA,Lipoxygenase,Lyase_aromatic,HMGL-like,Chalcone_3,Chalcone_2,Acetyltransf_1,UDPGT_2,GMC_oxred_N,GMC_oxred_C,Amino_oxidase,DAHP_synth_1,DAHP_synth_2], [Terpene_synth/Terpene_synth_C/Prenyltrans/SQHop_cyclase_C/SQHop_cyclase_N/PRISE]))

Genes:

Locus tag	Functional annotation	From	To	Strand	Category	Domains
Pdr17g005410	(E)-beta-ocimene synthase	4335352	4340040	+	Terpene synthase	Terpene_synth_C (E=3.6e-08), Terpene_synth (E=2.3e-22)
Pdr17g005420	tricyclene synthase EBOS	4350835	4354421	+	Terpene synthase	Terpene_synth_C (E=4.9e-35), Terpene_synth (E=8.5e-25)
Pdr17g005430	tricyclene synthase EBOS	4365991	4385021	+	Terpene synthase	Terpene_synth (E=2.2e-25)
Pdr17g005440	BTB/POZ domain-containing protein	4391091	4393682	-	Other genes	n/a
Pdr17g005450	scarecrow-like protein 32	4398459	4399790	-	Other genes	n/a
Pdr17g005460	hypothetical protein	4405371	4405872	+	Other genes	n/a
Pdr17g005470	histone-lysine N-methyltransferase ATXR3	4409941	4420276	+	Other genes	n/a
Pdr17g005480	transcription factor bHLH117	4422058	4423305	+	Other genes	n/a
Pdr17g005490	hypothetical protein	4427466	4428335	+	Other genes	n/a
Pdr17g005500	terpene synthase 9	4428848	4432052	-	Terpene synthase	Terpene_synth_C (E=8.9e-35), Terpene_synth (E=4.1e-22)
Pdr17g005510	terpene synthase 9	4439758	4442332	-	Terpene synthase	Terpene_synth_C (E=2.5e-06), Terpene_synth (E=8.2e-15)
Pdr17g005520	terpene synthase 9	4453394	4458273	-	Terpene synthase	Terpene_synth_C (E=5.2e-35), Terpene_synth (E=6.1e-21)
Pdr17g005530	mediator-associated protein 1-like	4467121	4468295	-	Other genes	n/a
Pdr17g005540	protein phosphatase 2C 37-like	4469025	4469414	+	Other genes	n/a

Show:

biosynthetic genesother genes

Legend:

Cytochrome 450

Terpene synthase

Copper amine oxidase

Pictet-Spengler enzyme (Bet v1)

Glycosyltransferase

Ketosynthase

Squalene epoxidase

COesterase

Methyltransferase

BAHD acyltransferase

Scl acyltransferase

Epimerase

Oxidoreductase

Dioxygenase

Transporter

CoA-ligase

Amino oxidase

Aminotransferase

Prenyltransferase

Strictosidine synthase-like

PRISE enzymes

Dirigent enzymes

Cellulose synthase-like

Fatty acid desaturase

Lipoxygenase

Polyprenyl synthetase

(Other) Biosynthetic Genes

Other Genes

biosynthetic genes

transport-related genes

regulatory genes

other genes

Chr17 - Cluster 19 - Saccharide

Gene cluster description

Download cluster GenBank file

Chr17 - Gene Cluster 19. Type = saccharide. Location: 6187632 - 6574942 nt. Click on genes for more information.

Show pHMM detection rules used

plants/plant: (minimum(4,[cMT,nMT,oMT,adh_short,Chal_sti_synt_C,Chal_sti_synt_N,COesterase,UDPGT,Glyco_transf_28,Glycos_transf_1,Glycos_transf_2,Lycopene_cycl,NAD_binding_1,p450,SQHop_cyclase_C,SQHop_cyclase_N,Prenyltrans,Terpene_synth_C,Terpene_synth,Transferase,Aminotran_1_2,AMP-binding,DIOX_N,Dirigent,Bet_v_1,Cu_amine_oxid,Str_synth,Trp_syntA,His_biosynth,adh_short_C2,Peptidase_S10,Prenyltransf,Epimerase,2OG-FeII_Oxy,Aminotran_3,Methyltransf_2,Methyltransf_3,Methyltransf_7,PRISE,Cellulose_synt,Chalcone,ERG4_ERG24,FA_desaturase,FA_desaturase_2,Methyltransf_11,polyprenyl_synt,SE,SQS_PSY,TPMT,UbiA,Lipoxygenase,Lyase_aromatic,HMGL-like,Chalcone_3,Chalcone_2,Acetyltransf_1,UDPGT_2,GMC_oxred_N,GMC_oxred_C,Amino_oxidase,DAHP_synth_1,DAHP_synth_2], []))
plants/saccharide: (minimum(3,[cMT,nMT,oMT,adh_short,Chal_sti_synt_C,Chal_sti_synt_N,COesterase,UDPGT,Glyco_transf_28,Glycos_transf_1,Glycos_transf_2,Lycopene_cycl,NAD_binding_1,p450,SQHop_cyclase_C,SQHop_cyclase_N,Prenyltrans,Terpene_synth_C,Terpene_synth,Transferase,Aminotran_1_2,AMP-binding,DIOX_N,Dirigent,Bet_v_1,Cu_amine_oxid,Str_synth,Trp_syntA,His_biosynth,adh_short_C2,Peptidase_S10,Prenyltransf,Epimerase,2OG-FeII_Oxy,Aminotran_3,Methyltransf_2,Methyltransf_3,Methyltransf_7,PRISE,Cellulose_synt,Chalcone,ERG4_ERG24,FA_desaturase,FA_desaturase_2,Methyltransf_11,polyprenyl_synt,SE,SQS_PSY,TPMT,UbiA,Lipoxygenase,Lyase_aromatic,HMGL-like,Chalcone_3,Chalcone_2,Acetyltransf_1,UDPGT_2,GMC_oxred_N,GMC_oxred_C,Amino_oxidase,DAHP_synth_1,DAHP_synth_2], [Glycos_transf_1/Glycos_transf_2/Glycos_transf_28/UDPGT/UDPGT_2]))

Genes:

Locus tag	Functional annotation	From	To	Strand	Category	Domains
Pdr17g007360	7-deoxyloganetin glucosyltransferase-like	6204934	6206513	-	Glycosyltransferase	UDPGT_2 (E=1.3e-24)
Pdr17g007370	7-deoxyloganetin glucosyltransferase-like	6217677	6219204	-	Glycosyltransferase	UDPGT_2 (E=3e-19)
Pdr17g007380	fruit protein pKIWI502-like	6221508	6223743	+	Other genes	n/a
Pdr17g007390	hypothetical protein	6236988	6239017	-	Other genes	n/a
Pdr17g007400	aspartic proteinase nepenthesin-1	6239351	6239707	+	Other genes	n/a
Pdr17g007410	F-box protein	6242441	6243168	-	Other genes	n/a
Pdr17g007420	7-deoxyloganetin glucosyltransferase-like	6260940	6262680	-	Glycosyltransferase	UDPGT_2 (E=5.3e-22)
Pdr17g007430	7-deoxyloganetin glucosyltransferase-like	6273645	6274816	-	Other genes	n/a
Pdr17g007440	7-deoxyloganetin glucosyltransferase-like	6302997	6304605	-	Other genes	n/a
Pdr17g007450	7-deoxyloganetin glucosyltransferase-like	6325979	6327521	-	Glycosyltransferase	UDPGT_2 (E=1.3e-25)
Pdr17g007460	cold shock domain-containing protein 3-like	6328413	6329761	-	Other genes	n/a
Pdr17g007470	hypothetical protein	6371901	6372335	+	Other genes	n/a
Pdr17g007480	7-deoxyloganetin glucosyltransferase-like	6379112	6381109	-	Glycosyltransferase	UDPGT_2 (E=3.9e-23)
Pdr17g007490	7-deoxyloganetin glucosyltransferase-like	6406706	6408351	-	Glycosyltransferase	UDPGT_2 (E=8.9e-25)
Pdr17g007500	7-deoxyloganetin glucosyltransferase-like	6427580	6429133	-	Glycosyltransferase	UDPGT_2 (E=2.4e-22)
Pdr17g007510	UDP-glycosyltransferase 85A3-like	6446036	6446465	-	Other genes	n/a
Pdr17g007520	7-deoxyloganetin glucosyltransferase-like	6456319	6457964	-	Glycosyltransferase	UDPGT_2 (E=5.7e-25)
Pdr17g007530	7-deoxyloganetin glucosyltransferase-like	6470675	6472229	-	Glycosyltransferase	UDPGT_2 (E=2.7e-24)
Pdr17g007540	S ribonuclease	6479934	6480266	+	Other genes	n/a
Pdr17g007550	7-deoxyloganetin glucosyltransferase-like	6481518	6482045	-	Glycosyltransferase	UDPGT_2 (E=1.3e-11)
Pdr17g007560	hypothetical protein	6496664	6503764	+	Other genes	n/a
Pdr17g007570	protein PAT1 1-like	6505768	6511033	-	Other genes	n/a
Pdr17g007580	S2-RNase	6515508	6515774	-	Other genes	n/a
Pdr17g007590	UDP-arabinose 4-epimerase 1-like	6527680	6528390	+	Epimerase	Epimerase (E=4.4e-05)
Pdr17g007600	UDP-arabinose 4-epimerase 1-like	6532390	6534397	+	Epimerase	Epimerase (E=3.6e-16)
Pdr17g007610	heat shock 70 kDa protein 17-like	6534796	6544304	-	Other genes	n/a
Pdr17g007620	UDP-glycosyltransferase 82A1-like	6546158	6557640	-	Glycosyltransferase	UDPGT_2 (E=1.4e-13)
Pdr17g007630	cysteine-rich and transmembrane domain-containing protein B-like	6571452	6572346	+	Other genes	n/a
Pdr17g007640	hypothetical protein	6574727	6575599	-	Other genes	n/a

Show:

biosynthetic genesother genes

Legend:

Cytochrome 450

Terpene synthase

Copper amine oxidase

Pictet-Spengler enzyme (Bet v1)

Glycosyltransferase

Ketosynthase

Squalene epoxidase

COesterase

Methyltransferase

BAHD acyltransferase

Scl acyltransferase

Epimerase

Oxidoreductase

Dioxygenase

Transporter

CoA-ligase

Amino oxidase

Aminotransferase

Prenyltransferase

Strictosidine synthase-like

PRISE enzymes

Dirigent enzymes

Cellulose synthase-like

Fatty acid desaturase

Lipoxygenase

Polyprenyl synthetase

(Other) Biosynthetic Genes

Other Genes

biosynthetic genes

transport-related genes

regulatory genes

other genes

Chr17 - Cluster 20 - Saccharide

Gene cluster description

Download cluster GenBank file

Chr17 - Gene Cluster 20. Type = saccharide. Location: 6597429 - 6735642 nt. Click on genes for more information.

Show pHMM detection rules used

plants/saccharide: (minimum(3,[cMT,nMT,oMT,adh_short,Chal_sti_synt_C,Chal_sti_synt_N,COesterase,UDPGT,Glyco_transf_28,Glycos_transf_1,Glycos_transf_2,Lycopene_cycl,NAD_binding_1,p450,SQHop_cyclase_C,SQHop_cyclase_N,Prenyltrans,Terpene_synth_C,Terpene_synth,Transferase,Aminotran_1_2,AMP-binding,DIOX_N,Dirigent,Bet_v_1,Cu_amine_oxid,Str_synth,Trp_syntA,His_biosynth,adh_short_C2,Peptidase_S10,Prenyltransf,Epimerase,2OG-FeII_Oxy,Aminotran_3,Methyltransf_2,Methyltransf_3,Methyltransf_7,PRISE,Cellulose_synt,Chalcone,ERG4_ERG24,FA_desaturase,FA_desaturase_2,Methyltransf_11,polyprenyl_synt,SE,SQS_PSY,TPMT,UbiA,Lipoxygenase,Lyase_aromatic,HMGL-like,Chalcone_3,Chalcone_2,Acetyltransf_1,UDPGT_2,GMC_oxred_N,GMC_oxred_C,Amino_oxidase,DAHP_synth_1,DAHP_synth_2], [Glycos_transf_1/Glycos_transf_2/Glycos_transf_28/UDPGT/UDPGT_2]))

Genes:

Locus tag	Functional annotation	From	To	Strand	Category	Domains
Pdr17g007690	myosin-9	6594438	6599161	-	Other genes	n/a
Pdr17g007700	gamma-aminobutyrate transaminase 3	6606800	6612330	-	Aminotransferase	Aminotran_3 (E=1.6e-49)
Pdr17g007710	hypothetical protein	6623729	6626173	+	Other genes	n/a
Pdr17g007720	protein S-acyltransferase 19	6628510	6633396	-	Other genes	n/a
Pdr17g007730	protein FAR-RED ELONGATED HYPOCOTYL 3-like	6647221	6650649	+	Other genes	n/a
Pdr17g007740	F-box family protein	6652943	6653287	-	Other genes	n/a
Pdr17g007750	protein FAR1-RELATED SEQUENCE 2	6654602	6658284	+	Other genes	n/a
Pdr17g007760	cytochrome P450 97B2	6658615	6662976	-	Cytochrome 450	p450 (E=3.5e-57)
Pdr17g007770	hypothetical protein	6675717	6676460	+	Other genes	n/a
Pdr17g007780	pectinesterase 8	6681557	6683723	+	Other genes	n/a
Pdr17g007790	choline-phosphate cytidylyltransferase 2-like	6689698	6692779	+	Other genes	n/a
Pdr17g007800	UDP-glucose flavonoid 3-O-glucosyltransferase 3	6694562	6695986	-	Glycosyltransferase	UDPGT_2 (E=3.3e-67)
Pdr17g007810	pentatricopeptide repeat-containing protein	6717629	6719257	-	Other genes	n/a
Pdr17g007820	pentatricopeptide repeat-containing protein	6719717	6720100	+	Other genes	n/a
Pdr17g007830	UDP-glucose flavonoid 3-O-glucosyltransferase 3	6724847	6726271	-	Glycosyltransferase	UDPGT_2 (E=2.4e-68)
Pdr17g007840	hypothetical protein	6727326	6728297	-	Other genes	n/a
Pdr17g007850	sulfated surface glycoprotein 185-like	6731595	6734324	+	Other genes	n/a

Show:

biosynthetic genesother genes

Legend:

Cytochrome 450

Terpene synthase

Copper amine oxidase

Pictet-Spengler enzyme (Bet v1)

Glycosyltransferase

Ketosynthase

Squalene epoxidase

COesterase

Methyltransferase

BAHD acyltransferase

Scl acyltransferase

Epimerase

Oxidoreductase

Dioxygenase

Transporter

CoA-ligase

Amino oxidase

Aminotransferase

Prenyltransferase

Strictosidine synthase-like

PRISE enzymes

Dirigent enzymes

Cellulose synthase-like

Fatty acid desaturase

Lipoxygenase

Polyprenyl synthetase

(Other) Biosynthetic Genes

Other Genes

biosynthetic genes

transport-related genes

regulatory genes

other genes

Chr3 - Cluster 21 - Terpene

Gene cluster description

Download cluster GenBank file

Chr3 - Gene Cluster 21. Type = terpene. Location: 13434850 - 13538446 nt. Click on genes for more information.

Show pHMM detection rules used

plants/terpene: (minimum(3,[cMT,nMT,oMT,adh_short,Chal_sti_synt_C,Chal_sti_synt_N,COesterase,UDPGT,Glyco_transf_28,Glycos_transf_1,Glycos_transf_2,Lycopene_cycl,NAD_binding_1,p450,SQHop_cyclase_C,SQHop_cyclase_N,Prenyltrans,Terpene_synth_C,Terpene_synth,Transferase,Aminotran_1_2,AMP-binding,DIOX_N,Dirigent,Bet_v_1,Cu_amine_oxid,Str_synth,Trp_syntA,His_biosynth,adh_short_C2,Peptidase_S10,Prenyltransf,Epimerase,2OG-FeII_Oxy,Aminotran_3,Methyltransf_2,Methyltransf_3,Methyltransf_7,PRISE,Cellulose_synt,Chalcone,ERG4_ERG24,FA_desaturase,FA_desaturase_2,Methyltransf_11,polyprenyl_synt,SE,SQS_PSY,TPMT,UbiA,Lipoxygenase,Lyase_aromatic,HMGL-like,Chalcone_3,Chalcone_2,Acetyltransf_1,UDPGT_2,GMC_oxred_N,GMC_oxred_C,Amino_oxidase,DAHP_synth_1,DAHP_synth_2], [Terpene_synth/Terpene_synth_C/Prenyltrans/SQHop_cyclase_C/SQHop_cyclase_N/PRISE]))

Genes:

Locus tag	Functional annotation	From	To	Strand	Category	Domains
Pdr3g009030	hypothetical protein	13438995	13439345	-	Other genes	n/a
Pdr3g009040	ent-kaur-16-ene synthase	13445872	13450261	-	Terpene synthase	Terpene_synth_C (E=1.8e-17)
Pdr3g009050	hypothetical protein	13461766	13462474	+	Other genes	n/a
Pdr3g009060	cytochrome P450 71D9-like	13466216	13472866	+	Cytochrome 450	p450 (E=7.3e-63)
Pdr3g009070	receptor-like serine/threonine-protein kinase SD1-8	13474120	13484083	-	Other genes	n/a
Pdr3g009080	hypothetical protein	13490363	13493550	+	Other genes	n/a
Pdr3g009090	NAC transcription factor 29-like	13495177	13496508	-	Other genes	n/a
Pdr3g009100	CAAX prenyl protease 2-like	13509698	13510130	+	Other genes	n/a
Pdr3g009110	pentatricopeptide repeat-containing protein	13512894	13514873	-	Other genes	n/a
Pdr3g009120	hypothetical protein	13521254	13522002	-	Other genes	n/a
Pdr3g009130	hypothetical protein	13525627	13527424	+	Cytochrome 450	p450 (E=1.4e-107)
Pdr3g009140	ABC transporter C family member 3-like	13535750	13541414	+	Other genes	n/a

Show:

biosynthetic genesother genes

Legend:

Cytochrome 450

Terpene synthase

Copper amine oxidase

Pictet-Spengler enzyme (Bet v1)

Glycosyltransferase

Ketosynthase

Squalene epoxidase

COesterase

Methyltransferase

BAHD acyltransferase

Scl acyltransferase

Epimerase

Oxidoreductase

Dioxygenase

Transporter

CoA-ligase

Amino oxidase

Aminotransferase

Prenyltransferase

Strictosidine synthase-like

PRISE enzymes

Dirigent enzymes

Cellulose synthase-like

Fatty acid desaturase

Lipoxygenase

Polyprenyl synthetase

(Other) Biosynthetic Genes

Other Genes

biosynthetic genes

transport-related genes

regulatory genes

other genes

Chr3 - Cluster 22 - Terpene

Gene cluster description

Download cluster GenBank file

Chr3 - Gene Cluster 22. Type = terpene. Location: 15511742 - 15670145 nt. Click on genes for more information.

Show pHMM detection rules used

plants/plant: (minimum(4,[cMT,nMT,oMT,adh_short,Chal_sti_synt_C,Chal_sti_synt_N,COesterase,UDPGT,Glyco_transf_28,Glycos_transf_1,Glycos_transf_2,Lycopene_cycl,NAD_binding_1,p450,SQHop_cyclase_C,SQHop_cyclase_N,Prenyltrans,Terpene_synth_C,Terpene_synth,Transferase,Aminotran_1_2,AMP-binding,DIOX_N,Dirigent,Bet_v_1,Cu_amine_oxid,Str_synth,Trp_syntA,His_biosynth,adh_short_C2,Peptidase_S10,Prenyltransf,Epimerase,2OG-FeII_Oxy,Aminotran_3,Methyltransf_2,Methyltransf_3,Methyltransf_7,PRISE,Cellulose_synt,Chalcone,ERG4_ERG24,FA_desaturase,FA_desaturase_2,Methyltransf_11,polyprenyl_synt,SE,SQS_PSY,TPMT,UbiA,Lipoxygenase,Lyase_aromatic,HMGL-like,Chalcone_3,Chalcone_2,Acetyltransf_1,UDPGT_2,GMC_oxred_N,GMC_oxred_C,Amino_oxidase,DAHP_synth_1,DAHP_synth_2], []))
plants/terpene: (minimum(3,[cMT,nMT,oMT,adh_short,Chal_sti_synt_C,Chal_sti_synt_N,COesterase,UDPGT,Glyco_transf_28,Glycos_transf_1,Glycos_transf_2,Lycopene_cycl,NAD_binding_1,p450,SQHop_cyclase_C,SQHop_cyclase_N,Prenyltrans,Terpene_synth_C,Terpene_synth,Transferase,Aminotran_1_2,AMP-binding,DIOX_N,Dirigent,Bet_v_1,Cu_amine_oxid,Str_synth,Trp_syntA,His_biosynth,adh_short_C2,Peptidase_S10,Prenyltransf,Epimerase,2OG-FeII_Oxy,Aminotran_3,Methyltransf_2,Methyltransf_3,Methyltransf_7,PRISE,Cellulose_synt,Chalcone,ERG4_ERG24,FA_desaturase,FA_desaturase_2,Methyltransf_11,polyprenyl_synt,SE,SQS_PSY,TPMT,UbiA,Lipoxygenase,Lyase_aromatic,HMGL-like,Chalcone_3,Chalcone_2,Acetyltransf_1,UDPGT_2,GMC_oxred_N,GMC_oxred_C,Amino_oxidase,DAHP_synth_1,DAHP_synth_2], [Terpene_synth/Terpene_synth_C/Prenyltrans/SQHop_cyclase_C/SQHop_cyclase_N/PRISE]))

Genes:

Locus tag	Functional annotation	From	To	Strand	Category	Domains
Pdr3g011350	hypothetical protein	15512288	15512500	+	Other genes	n/a
Pdr3g011360	histone H2A.6-like	15513323	15514446	-	Other genes	n/a
Pdr3g011370	2-oxoglutarate-dependent dioxygenase AOP1	15522498	15523136	-	Dioxygenase	2OG-FeII_Oxy (E=1.6e-15)
Pdr3g011380	2-oxoglutarate-dependent dioxygenase AOP3-like	15525655	15525915	+	Other genes	n/a
Pdr3g011390	hypothetical protein	15531747	15533768	+	Other genes	n/a
Pdr3g011400	dihydroflavonol-4-reductase-like	15539227	15541884	-	Epimerase	Epimerase (E=9e-05)
Pdr3g011410	short-chain type dehydrogenase/reductase-like	15561595	15562410	-	Oxidoreductase	adh_short_C2 (E=1.2e-61)
Pdr3g011420	leucine-rich repeat receptor-like serine/threonine-protein kinase	15568244	15571337	-	Other genes	n/a
Pdr3g011430	hypothetical protein	15576282	15576944	+	Other genes	n/a
Pdr3g011440	chitin-inducible gibberellin-responsive protein 1-like	15595254	15597002	+	Other genes	n/a
Pdr3g011450	cytochrome P450 71A25-like	15604757	15607630	-	Cytochrome 450	p450 (E=2.6e-103)
Pdr3g011460	UDP-glycosyltransferase 85A5-like	15608816	15609127	+	Other genes	n/a
Pdr3g011470	(-)-alpha-pinene synthase-like	15621921	15626642	+	Terpene synthase	Terpene_synth_C (E=5.6e-41), Terpene_synth (E=3.4e-27)
Pdr3g011480	organic cation/carnitine transporter 4-like	15631159	15637130	+	Other genes	n/a
Pdr3g011490	hypothetical protein	15638633	15639257	-	Other genes	n/a
Pdr3g011500	glycine-rich RNA-binding protein 4	15644316	15647190	-	Other genes	n/a
Pdr3g011510	F-box/kelch-repeat protein	15649361	15649627	+	Other genes	n/a
Pdr3g011520	beta-glucosidase 41	15651386	15654635	+	Other genes	n/a
Pdr3g011530	mRNA cap guanine-N7 methyltransferase 1	15656203	15659389	+	Methyltransferase	Methyltransf_11 (E=8.9e-11)
Pdr3g011540	hypothetical protein	15660313	15661885	-	Other genes	n/a
Pdr3g011550	hypothetical protein	15664969	15666551	-	Other genes	n/a

Show:

biosynthetic genesother genes

Legend:

Cytochrome 450

Terpene synthase

Copper amine oxidase

Pictet-Spengler enzyme (Bet v1)

Glycosyltransferase

Ketosynthase

Squalene epoxidase

COesterase

Methyltransferase

BAHD acyltransferase

Scl acyltransferase

Epimerase

Oxidoreductase

Dioxygenase

Transporter

CoA-ligase

Amino oxidase

Aminotransferase

Prenyltransferase

Strictosidine synthase-like

PRISE enzymes

Dirigent enzymes

Cellulose synthase-like

Fatty acid desaturase

Lipoxygenase

Polyprenyl synthetase

(Other) Biosynthetic Genes

Other Genes

biosynthetic genes

transport-related genes

regulatory genes

other genes

Chr3 - Cluster 23 - Terpene

Gene cluster description

Download cluster GenBank file

Chr3 - Gene Cluster 23. Type = terpene. Location: 22229674 - 22348512 nt. Click on genes for more information.

Show pHMM detection rules used

plants/terpene: (minimum(3,[cMT,nMT,oMT,adh_short,Chal_sti_synt_C,Chal_sti_synt_N,COesterase,UDPGT,Glyco_transf_28,Glycos_transf_1,Glycos_transf_2,Lycopene_cycl,NAD_binding_1,p450,SQHop_cyclase_C,SQHop_cyclase_N,Prenyltrans,Terpene_synth_C,Terpene_synth,Transferase,Aminotran_1_2,AMP-binding,DIOX_N,Dirigent,Bet_v_1,Cu_amine_oxid,Str_synth,Trp_syntA,His_biosynth,adh_short_C2,Peptidase_S10,Prenyltransf,Epimerase,2OG-FeII_Oxy,Aminotran_3,Methyltransf_2,Methyltransf_3,Methyltransf_7,PRISE,Cellulose_synt,Chalcone,ERG4_ERG24,FA_desaturase,FA_desaturase_2,Methyltransf_11,polyprenyl_synt,SE,SQS_PSY,TPMT,UbiA,Lipoxygenase,Lyase_aromatic,HMGL-like,Chalcone_3,Chalcone_2,Acetyltransf_1,UDPGT_2,GMC_oxred_N,GMC_oxred_C,Amino_oxidase,DAHP_synth_1,DAHP_synth_2], [Terpene_synth/Terpene_synth_C/Prenyltrans/SQHop_cyclase_C/SQHop_cyclase_N/PRISE]))

Genes:

Locus tag	Functional annotation	From	To	Strand	Category	Domains
Pdr3g019070	hypothetical protein	22235432	22239367	-	Other genes	n/a
Pdr3g019080	dehydrodolichyl diphosphate synthase 2-like	22239756	22242259	-	Prenyltransferase	Prenyltransf (E=3.2e-24)
Pdr3g019090	dehydrodolichyl diphosphate synthase 2	22247778	22249260	-	Prenyltransferase	Prenyltransf (E=1.7e-25)
Pdr3g019100	disease resistance protein	22252699	22257752	+	Other genes	n/a
Pdr3g019110	protein DAMAGED DNA-BINDING 2-like	22258074	22260827	+	Other genes	n/a
Pdr3g019120	3-oxo-Delta(4-5)-steroid 5-beta-reductase-like	22263654	22265016	-	PRISE enzymes	PRISE (E=5.7e-39)
Pdr3g019130	vacuolar cation/proton exchanger 3-like	22269774	22273398	-	Other genes	n/a
Pdr3g019140	nudC domain-containing protein 2-like	22276446	22277919	+	Other genes	n/a
Pdr3g019150	hypothetical protein	22287167	22288726	+	Other genes	n/a
Pdr3g019160	hypothetical protein	22289065	22289331	+	Other genes	n/a
Pdr3g019170	hypothetical protein	22292479	22297928	+	Other genes	n/a
Pdr3g019180	2-oxoglutarate-dependent dioxygenase AOP3-like	22299876	22301687	-	Dioxygenase	2OG-FeII_Oxy (E=1.8e-12)
Pdr3g019190	2-oxoglutarate-dependent dioxygenase AOP3-like	22316640	22318194	-	Other genes	n/a
Pdr3g019200	2-oxoglutarate-dependent dioxygenase AOP3-like	22336835	22338430	-	Dioxygenase	DIOX_N (E=1.4e-07)

Show:

biosynthetic genesother genes

Legend:

Cytochrome 450

Terpene synthase

Copper amine oxidase

Pictet-Spengler enzyme (Bet v1)

Glycosyltransferase

Ketosynthase

Squalene epoxidase

COesterase

Methyltransferase

BAHD acyltransferase

Scl acyltransferase

Epimerase

Oxidoreductase

Dioxygenase

Transporter

CoA-ligase

Amino oxidase

Aminotransferase

Prenyltransferase

Strictosidine synthase-like

PRISE enzymes

Dirigent enzymes

Cellulose synthase-like

Fatty acid desaturase

Lipoxygenase

Polyprenyl synthetase

(Other) Biosynthetic Genes

Other Genes

biosynthetic genes

transport-related genes

regulatory genes

other genes

Chr4 - Cluster 24 - Saccharide

Gene cluster description

Download cluster GenBank file

Chr4 - Gene Cluster 24. Type = saccharide. Location: 21806535 - 21997222 nt. Click on genes for more information.

Show pHMM detection rules used

plants/saccharide: (minimum(3,[cMT,nMT,oMT,adh_short,Chal_sti_synt_C,Chal_sti_synt_N,COesterase,UDPGT,Glyco_transf_28,Glycos_transf_1,Glycos_transf_2,Lycopene_cycl,NAD_binding_1,p450,SQHop_cyclase_C,SQHop_cyclase_N,Prenyltrans,Terpene_synth_C,Terpene_synth,Transferase,Aminotran_1_2,AMP-binding,DIOX_N,Dirigent,Bet_v_1,Cu_amine_oxid,Str_synth,Trp_syntA,His_biosynth,adh_short_C2,Peptidase_S10,Prenyltransf,Epimerase,2OG-FeII_Oxy,Aminotran_3,Methyltransf_2,Methyltransf_3,Methyltransf_7,PRISE,Cellulose_synt,Chalcone,ERG4_ERG24,FA_desaturase,FA_desaturase_2,Methyltransf_11,polyprenyl_synt,SE,SQS_PSY,TPMT,UbiA,Lipoxygenase,Lyase_aromatic,HMGL-like,Chalcone_3,Chalcone_2,Acetyltransf_1,UDPGT_2,GMC_oxred_N,GMC_oxred_C,Amino_oxidase,DAHP_synth_1,DAHP_synth_2], [Glycos_transf_1/Glycos_transf_2/Glycos_transf_28/UDPGT/UDPGT_2]))

Genes:

Locus tag	Functional annotation	From	To	Strand	Category	Domains
Pdr4g020190	hypothetical protein	21806645	21810237	-	Other genes	n/a
Pdr4g020200	hypothetical protein	21817315	21817497	+	Other genes	n/a
Pdr4g020210	anthocyanidin 3-O-glucoside 5-O-glucosyltransferase-like	21819795	21820928	+	Glycosyltransferase	UDPGT_2 (E=9e-19)
Pdr4g020220	crocetin glucosyltransferase	21823646	21825070	+	Glycosyltransferase	UDPGT_2 (E=1.6e-74)
Pdr4g020230	UDP-glucose:flavonoid 7-O-glucosyltransferase	21835652	21837097	+	Glycosyltransferase	UDPGT_2 (E=1.4e-70)
Pdr4g020240	hypothetical protein	21861451	21861903	+	Other genes	n/a
Pdr4g020250	crocetin glucosyltransferase	21891095	21892519	+	Glycosyltransferase	UDPGT_2 (E=2.5e-73)
Pdr4g020260	hypothetical protein	21912276	21912533	-	Other genes	n/a
Pdr4g020270	hypothetical protein	21912780	21913199	-	Other genes	n/a
Pdr4g020280	receptor protein kinase TMK1	21917130	21920350	+	Other genes	n/a
Pdr4g020290	glucan endo-1	21942590	21944789	+	Other genes	n/a
Pdr4g020300	acyl-activating enzyme 16	21946490	21955182	+	CoA-ligase	AMP-binding (E=1.3e-48)
Pdr4g020310	F-box protein	21957584	21958831	+	Other genes	n/a
Pdr4g020320	acyl-activating enzyme 16	21962501	21967227	+	CoA-ligase	AMP-binding (E=4.3e-12)
Pdr4g020330	hypothetical protein	21967794	21970789	-	Other genes	n/a
Pdr4g020340	phytoene dehydrogenase	21975798	21983962	-	Amino oxidase	Amino_oxidase (E=4.2e-16)
Pdr4g020350	coatomer subunit beta-1	21993429	21999128	+	Other genes	n/a

Show:

biosynthetic genesother genes

Legend:

Cytochrome 450

Terpene synthase

Copper amine oxidase

Pictet-Spengler enzyme (Bet v1)

Glycosyltransferase

Ketosynthase

Squalene epoxidase

COesterase

Methyltransferase

BAHD acyltransferase

Scl acyltransferase

Epimerase

Oxidoreductase

Dioxygenase

Transporter

CoA-ligase

Amino oxidase

Aminotransferase

Prenyltransferase

Strictosidine synthase-like

PRISE enzymes

Dirigent enzymes

Cellulose synthase-like

Fatty acid desaturase

Lipoxygenase

Polyprenyl synthetase

(Other) Biosynthetic Genes

Other Genes

biosynthetic genes

transport-related genes

regulatory genes

other genes

Chr4 - Cluster 25 - Cyclopeptide

Gene cluster description

Download cluster GenBank file

Chr4 - Gene Cluster 25. Type = cyclopeptide. Location: 22305725 - 22600500 nt. Click on genes for more information.

Show pHMM detection rules used

plants/cyclopeptide: (BURP)

Genes:

Locus tag	Functional annotation	From	To	Strand	Category	Domains
Pdr4g020690	crocetin glucosyltransferase	22321629	22323053	+	Glycosyltransferase	n/a
Pdr4g020700	crocetin glucosyltransferase	22333699	22335144	+	Glycosyltransferase	n/a
Pdr4g020710	crocetin glucosyltransferase	22365618	22367042	+	Glycosyltransferase	n/a
Pdr4g020720	hypothetical protein	22377519	22377776	-	Other genes	n/a
Pdr4g020730	hypothetical protein	22378023	22378442	-	Other genes	n/a
Pdr4g020740	receptor protein kinase TMK1	22382396	22385616	+	Other genes	n/a
Pdr4g020750	glucan endo-1	22397796	22401639	+	Other genes	n/a
Pdr4g020760	acyl-activating enzyme 16	22403303	22411973	+	CoA-ligase	n/a
Pdr4g020770	F-box protein	22414398	22415645	+	Other genes	n/a
Pdr4g020780	acyl-activating enzyme 16	22419239	22426505	+	CoA-ligase	n/a
Pdr4g020790	pentatricopeptide repeat-containing protein	22428272	22430104	+	Other genes	n/a
Pdr4g020800	selenium-binding protein 2	22432951	22436944	+	Other genes	n/a
Pdr4g020810	thaumatin-like protein 1b	22454464	22455456	+	Other genes	n/a
Pdr4g020820	dehydration-responsive protein RD22-like	22490385	22494339	+	(Other) biosynthetic genes	BURP (E=1.9e-82)
Pdr4g020830	protein RALF-like 32	22497284	22497622	+	Other genes	n/a
Pdr4g020840	histidine protein methyltransferase 1-like protein	22498854	22501521	-	Other genes	n/a
Pdr4g020850	xyloglucan galactosyltransferase KATAMARI1-like protein	22504850	22506307	+	Other genes	n/a
Pdr4g020860	xyloglucan galactosyltransferase KATAMARI1-like	22508737	22510215	-	Other genes	n/a
Pdr4g020870	xyloglucan galactosyltransferase KATAMARI1-like protein	22515376	22516839	-	Other genes	n/a
Pdr4g020880	xyloglucan galactosyltransferase KATAMARI1-like protein	22523888	22524330	-	Other genes	n/a
Pdr4g020890	heat stress transcription factor A-5	22527501	22529951	+	Other genes	n/a
Pdr4g020900	protein RALF-like 24	22531923	22533444	+	Other genes	n/a
Pdr4g020910	adenosylhomocysteinase	22542086	22543746	-	Other genes	n/a
Pdr4g020920	serine hydroxymethyltransferase 4	22550062	22552732	+	Other genes	n/a
Pdr4g020930	DNA repair protein RAD50	22553884	22566712	-	Other genes	n/a
Pdr4g020940	Werner Syndrome-like exonuclease	22567944	22572427	+	Other genes	n/a
Pdr4g020950	acyl-activating enzyme 16	22579712	22585990	+	CoA-ligase	n/a
Pdr4g020960	pentatricopeptide repeat-containing protein	22587756	22589588	+	Other genes	n/a
Pdr4g020970	selenium-binding protein 2	22592435	22596558	+	Other genes	n/a

Show:

biosynthetic genesother genes

Legend:

Cytochrome 450

Terpene synthase

Copper amine oxidase

Pictet-Spengler enzyme (Bet v1)

Glycosyltransferase

Ketosynthase

Squalene epoxidase

COesterase

Methyltransferase

BAHD acyltransferase

Scl acyltransferase

Epimerase

Oxidoreductase

Dioxygenase

Transporter

CoA-ligase

Amino oxidase

Aminotransferase

Prenyltransferase

Strictosidine synthase-like

PRISE enzymes

Dirigent enzymes

Cellulose synthase-like

Fatty acid desaturase

Lipoxygenase

Polyprenyl synthetase

(Other) Biosynthetic Genes

Other Genes

biosynthetic genes

transport-related genes

regulatory genes

other genes

Chr5 - Cluster 26 - Cyclopeptide

Gene cluster description

Download cluster GenBank file

Chr5 - Gene Cluster 26. Type = cyclopeptide. Location: 8404514 - 9284703 nt. Click on genes for more information.

Show pHMM detection rules used

plants/cyclopeptide: (BURP)

Genes:

Locus tag	Functional annotation	From	To	Strand	Category	Domains
Pdr5g006670	transcription factor RADIALIS-like	8410265	8410854	-	Other genes	n/a
Pdr5g006680	glycine-rich RNA-binding protein	8440067	8440880	-	Other genes	n/a
Pdr5g006690	transcription factor TCP19-like	8451064	8451729	-	Other genes	n/a
Pdr5g006700	LRR receptor-like serine/threonine-protein kinase	8506377	8511988	+	Other genes	n/a
Pdr5g006710	hypothetical protein	8515370	8519312	+	Other genes	n/a
Pdr5g006720	ribonuclease H protein	8532540	8539093	+	Other genes	n/a
Pdr5g006730	hypothetical protein	8539422	8543716	+	Other genes	n/a
Pdr5g006740	hypothetical protein	8549171	8549791	-	Other genes	n/a
Pdr5g006750	phenylalanine--tRNA ligase alpha subunit	8557517	8565988	-	Other genes	n/a
Pdr5g006760	NADH dehydrogenase [ubiquinone] iron-sulfur protein 8	8574998	8578521	-	Other genes	n/a
Pdr5g006770	hypothetical protein	8580604	8582632	+	Other genes	n/a
Pdr5g006780	hypothetical protein	8588537	8590370	+	Other genes	n/a
Pdr5g006790	BTB/POZ domain-containing protein	8590974	8593642	-	Other genes	n/a
Pdr5g006800	S ribonuclease	8604501	8604910	-	Other genes	n/a
Pdr5g006810	receptor-like serine/threonine-protein kinase	8642954	8645538	+	Other genes	n/a
Pdr5g006820	cyclase-associated protein 1	8647268	8651234	+	Other genes	n/a
Pdr5g006830	hypothetical protein	8652842	8653159	+	Other genes	n/a
Pdr5g006840	hypothetical protein	8672363	8674522	-	Other genes	n/a
Pdr5g006850	glucan endo-1	8676632	8683237	+	Other genes	n/a
Pdr5g006860	guanine nucleotide-binding protein subunit beta-1	8684810	8688970	+	Other genes	n/a
Pdr5g006870	coatomer subunit gamma-like	8690583	8696978	+	Other genes	n/a
Pdr5g006880	proline-rich receptor-like protein kinase PERK6	8698184	8701721	-	Other genes	n/a
Pdr5g006890	ras-related protein Rab7	8733528	8736837	+	Other genes	n/a
Pdr5g006900	SWI/SNF complex subunit SWI3D-like	8737858	8742875	-	Other genes	n/a
Pdr5g006910	hypothetical protein	8743523	8743828	+	Other genes	n/a
Pdr5g006920	organ-specific protein S2-like	8755325	8756576	-	Other genes	n/a
Pdr5g006930	hypothetical protein	8765085	8765386	+	Other genes	n/a
Pdr5g006940	hypothetical protein	8768006	8768242	+	Other genes	n/a
Pdr5g006950	organ-specific protein S2-like	8777365	8777800	-	Other genes	n/a
Pdr5g006960	BURP domain-containing protein 5-like	8801185	8801586	+	(Other) biosynthetic genes	BURP (E=7.6e-44)
Pdr5g006970	REF/SRPP-like protein	8835400	8835738	+	Other genes	n/a
Pdr5g006980	BAG family molecular chaperone regulator 1	8836641	8837258	+	Other genes	n/a
Pdr5g006990	BURP domain-containing protein 11-like	8885078	8888032	+	(Other) biosynthetic genes	BURP (E=5.6e-71)
Pdr5g007000	phosphatidylinositol 4-kinase alpha 1	8889807	8909633	-	Other genes	n/a
Pdr5g007010	mediator of RNA polymerase II transcription subunit 32-like	8944093	8944527	+	Other genes	n/a
Pdr5g007020	polyol transporter 1	8972376	8975860	-	Other genes	n/a
Pdr5g007030	hypothetical protein	9042378	9042754	+	Other genes	n/a
Pdr5g007040	polyol transporter 1	9063143	9065563	-	Other genes	n/a
Pdr5g007050	polyol transporter 5-like	9085309	9088680	-	Other genes	n/a
Pdr5g007060	hypothetical protein	9135116	9135412	+	Other genes	n/a
Pdr5g007070	G-type lectin S-receptor-like serine/threonine-protein kinase SD1-1	9143145	9145538	-	Other genes	n/a
Pdr5g007080	polyol transporter 1	9163322	9165947	-	Other genes	n/a
Pdr5g007090	hypothetical protein	9187388	9187696	-	Other genes	n/a
Pdr5g007100	hypothetical protein	9220914	9223092	+	Other genes	n/a
Pdr5g007110	S ribonuclease	9250084	9250413	-	Other genes	n/a
Pdr5g007120	BTB/POZ domain-containing protein NPY1-like	9277377	9278873	+	Other genes	n/a
Pdr5g007130	THO complex subunit 7A-like	9281119	9282567	+	Other genes	n/a

Show:

biosynthetic genesother genes

Legend:

Cytochrome 450

Terpene synthase

Copper amine oxidase

Pictet-Spengler enzyme (Bet v1)

Glycosyltransferase

Ketosynthase

Squalene epoxidase

COesterase

Methyltransferase

BAHD acyltransferase

Scl acyltransferase

Epimerase

Oxidoreductase

Dioxygenase

Transporter

CoA-ligase

Amino oxidase

Aminotransferase

Prenyltransferase

Strictosidine synthase-like

PRISE enzymes

Dirigent enzymes

Cellulose synthase-like

Fatty acid desaturase

Lipoxygenase

Polyprenyl synthetase

(Other) Biosynthetic Genes

Other Genes

biosynthetic genes

transport-related genes

regulatory genes

other genes

Chr5 - Cluster 27 - Cyclopeptide

Gene cluster description

Download cluster GenBank file

Chr5 - Gene Cluster 27. Type = cyclopeptide. Location: 9075805 - 10127570 nt. Click on genes for more information.

Show pHMM detection rules used

plants/cyclopeptide: (BURP)

Genes:

Locus tag	Functional annotation	From	To	Strand	Category	Domains
Pdr5g007050	polyol transporter 5-like	9085309	9088680	-	Other genes	n/a
Pdr5g007060	hypothetical protein	9135116	9135412	+	Other genes	n/a
Pdr5g007070	G-type lectin S-receptor-like serine/threonine-protein kinase SD1-1	9143145	9145538	-	Other genes	n/a
Pdr5g007080	polyol transporter 1	9163322	9165947	-	Other genes	n/a
Pdr5g007090	hypothetical protein	9187388	9187696	-	Other genes	n/a
Pdr5g007100	hypothetical protein	9220914	9223092	+	Other genes	n/a
Pdr5g007110	S ribonuclease	9250084	9250413	-	Other genes	n/a
Pdr5g007120	BTB/POZ domain-containing protein NPY1-like	9277377	9278873	+	Other genes	n/a
Pdr5g007130	THO complex subunit 7A-like	9281119	9282567	+	Other genes	n/a
Pdr5g007140	TMV resistance protein N-like	9293514	9298811	+	Other genes	n/a
Pdr5g007150	TMV resistance protein N-like	9301389	9301874	+	Other genes	n/a
Pdr5g007160	ion channel POLLUX-like 2	9319112	9319974	-	Other genes	n/a
Pdr5g007170	UDP-D-xylose:L-fucose alpha-1	9324051	9325912	+	Other genes	n/a
Pdr5g007180	cyclin-A2-3-like	9334412	9334594	-	Other genes	n/a
Pdr5g007190	deSI-like protein	9342197	9343814	+	Other genes	n/a
Pdr5g007200	dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit-like	9347739	9353129	+	Other genes	n/a
Pdr5g007210	lipid-transfer protein DIR1	9377323	9379102	-	Other genes	n/a
Pdr5g007220	annexin A7-like	9388242	9388981	-	Other genes	n/a
Pdr5g007230	hypothetical protein	9394149	9395128	+	Other genes	n/a
Pdr5g007240	hypothetical protein	9397547	9402668	-	Other genes	n/a
Pdr5g007250	protein CASP	9404193	9414174	+	Other genes	n/a
Pdr5g007260	hypothetical protein	9421911	9425139	+	Other genes	n/a
Pdr5g007270	protein CASP	9427460	9437523	-	Other genes	n/a
Pdr5g007280	hypothetical protein	9439948	9441075	-	Other genes	n/a
Pdr5g007290	plastid division protein PDV2	9478504	9482375	-	Other genes	n/a
Pdr5g007300	hypothetical protein	9495959	9497929	-	Other genes	n/a
Pdr5g007310	DNA-directed RNA polymerases II	9539850	9541131	-	Other genes	n/a
Pdr5g007320	E3 ubiquitin-protein ligase ARI1	9545537	9549329	-	Other genes	n/a
Pdr5g007330	hypothetical protein	9601026	9602349	-	(Other) biosynthetic genes	BURP (E=1.4e-15)
Pdr5g007340	4-hydroxy-3-methylbut-2-enyl diphosphate reductase	9629163	9631923	+	Other genes	n/a
Pdr5g007350	cytochrome c biogenesis protein CCS1	9634086	9637297	-	Other genes	n/a
Pdr5g007360	E3 ubiquitin-protein ligase ARI1	9654230	9657981	-	Other genes	n/a
Pdr5g007370	S ribonuclease	9696596	9696781	-	Other genes	n/a
Pdr5g007380	S ribonuclease	9708340	9708525	-	Other genes	n/a
Pdr5g007390	S ribonuclease	9720077	9720262	-	Other genes	n/a
Pdr5g007400	hypothetical protein	9741096	9742592	-	Other genes	n/a
Pdr5g007410	4-hydroxy-3-methylbut-2-enyl diphosphate reductase	9785785	9788852	+	Other genes	n/a
Pdr5g007420	cytochrome c biogenesis protein CCS1	9791088	9794239	-	Other genes	n/a
Pdr5g007430	hypothetical protein	9880887	9881612	-	Other genes	n/a
Pdr5g007440	hypothetical protein	9914746	9919287	+	Other genes	n/a
Pdr5g007450	hypothetical protein	9940148	9940495	+	Other genes	n/a
Pdr5g007460	hemoglobin-2-like	9979228	9980069	+	Other genes	n/a
Pdr5g007470	hemoglobin-2-like	9982594	9984454	+	Other genes	n/a
Pdr5g007480	14-3-3-like protein 16R	10037940	10040265	+	Other genes	n/a
Pdr5g007490	hypothetical protein	10070915	10071646	-	Other genes	n/a

Show:

biosynthetic genesother genes

Legend:

Cytochrome 450

Terpene synthase

Copper amine oxidase

Pictet-Spengler enzyme (Bet v1)

Glycosyltransferase

Ketosynthase

Squalene epoxidase

COesterase

Methyltransferase

BAHD acyltransferase

Scl acyltransferase

Epimerase

Oxidoreductase

Dioxygenase

Transporter

CoA-ligase

Amino oxidase

Aminotransferase

Prenyltransferase

Strictosidine synthase-like

PRISE enzymes

Dirigent enzymes

Cellulose synthase-like

Fatty acid desaturase

Lipoxygenase

Polyprenyl synthetase

(Other) Biosynthetic Genes

Other Genes

biosynthetic genes

transport-related genes

regulatory genes

other genes

Chr5 - Cluster 28 - Putative

Gene cluster description

Download cluster GenBank file

Chr5 - Gene Cluster 28. Type = putative. Location: 23437894 - 23493063 nt. Click on genes for more information.

Show pHMM detection rules used

plants/plant: (minimum(4,[cMT,nMT,oMT,adh_short,Chal_sti_synt_C,Chal_sti_synt_N,COesterase,UDPGT,Glyco_transf_28,Glycos_transf_1,Glycos_transf_2,Lycopene_cycl,NAD_binding_1,p450,SQHop_cyclase_C,SQHop_cyclase_N,Prenyltrans,Terpene_synth_C,Terpene_synth,Transferase,Aminotran_1_2,AMP-binding,DIOX_N,Dirigent,Bet_v_1,Cu_amine_oxid,Str_synth,Trp_syntA,His_biosynth,adh_short_C2,Peptidase_S10,Prenyltransf,Epimerase,2OG-FeII_Oxy,Aminotran_3,Methyltransf_2,Methyltransf_3,Methyltransf_7,PRISE,Cellulose_synt,Chalcone,ERG4_ERG24,FA_desaturase,FA_desaturase_2,Methyltransf_11,polyprenyl_synt,SE,SQS_PSY,TPMT,UbiA,Lipoxygenase,Lyase_aromatic,HMGL-like,Chalcone_3,Chalcone_2,Acetyltransf_1,UDPGT_2,GMC_oxred_N,GMC_oxred_C,Amino_oxidase,DAHP_synth_1,DAHP_synth_2], []))

Genes:

Locus tag	Functional annotation	From	To	Strand	Category	Domains
Pdr5g018490	BAHD acyltransferase	23438285	23439624	-	Other genes	n/a
Pdr5g018500	BAHD acyltransferase	23448338	23449588	-	BAHD acyltransferase	Transferase (E=4.4e-18)
Pdr5g018510	BAHD acyltransferase	23460434	23461732	-	BAHD acyltransferase	Transferase (E=5.2e-19)
Pdr5g018520	protein suppressor of npr1-1	23464414	23465257	-	Other genes	n/a
Pdr5g018530	cyclin-D3-2	23466978	23469700	+	Oxidoreductase	adh_short_C2 (E=3.2e-20)
Pdr5g018540	BAHD acyltransferase	23471735	23482619	-	BAHD acyltransferase	Transferase (E=3.8e-06)

Show:

biosynthetic genesother genes

Legend:

Cytochrome 450

Terpene synthase

Copper amine oxidase

Pictet-Spengler enzyme (Bet v1)

Glycosyltransferase

Ketosynthase

Squalene epoxidase

COesterase

Methyltransferase

BAHD acyltransferase

Scl acyltransferase

Epimerase

Oxidoreductase

Dioxygenase

Transporter

CoA-ligase

Amino oxidase

Aminotransferase

Prenyltransferase

Strictosidine synthase-like

PRISE enzymes

Dirigent enzymes

Cellulose synthase-like

Fatty acid desaturase

Lipoxygenase

Polyprenyl synthetase

(Other) Biosynthetic Genes

Other Genes

biosynthetic genes

transport-related genes

regulatory genes

other genes

Chr6 - Cluster 29 - Putative

Gene cluster description

Download cluster GenBank file

Chr6 - Gene Cluster 29. Type = putative. Location: 17414740 - 17557303 nt. Click on genes for more information.

Show pHMM detection rules used

plants/plant: (minimum(4,[cMT,nMT,oMT,adh_short,Chal_sti_synt_C,Chal_sti_synt_N,COesterase,UDPGT,Glyco_transf_28,Glycos_transf_1,Glycos_transf_2,Lycopene_cycl,NAD_binding_1,p450,SQHop_cyclase_C,SQHop_cyclase_N,Prenyltrans,Terpene_synth_C,Terpene_synth,Transferase,Aminotran_1_2,AMP-binding,DIOX_N,Dirigent,Bet_v_1,Cu_amine_oxid,Str_synth,Trp_syntA,His_biosynth,adh_short_C2,Peptidase_S10,Prenyltransf,Epimerase,2OG-FeII_Oxy,Aminotran_3,Methyltransf_2,Methyltransf_3,Methyltransf_7,PRISE,Cellulose_synt,Chalcone,ERG4_ERG24,FA_desaturase,FA_desaturase_2,Methyltransf_11,polyprenyl_synt,SE,SQS_PSY,TPMT,UbiA,Lipoxygenase,Lyase_aromatic,HMGL-like,Chalcone_3,Chalcone_2,Acetyltransf_1,UDPGT_2,GMC_oxred_N,GMC_oxred_C,Amino_oxidase,DAHP_synth_1,DAHP_synth_2], []))

Genes:

Locus tag	Functional annotation	From	To	Strand	Category	Domains
Pdr6g012420	cytochrome P450 CYP749A22-like	17424861	17440293	-	Cytochrome 450	p450 (E=1e-19)
Pdr6g012430	cytochrome P450 CYP749A22-like	17446743	17463271	-	Cytochrome 450	p450 (E=8.9e-30)
Pdr6g012440	cytochrome P450 CYP749A22-like	17464612	17466521	-	Cytochrome 450	p450 (E=8.6e-31)
Pdr6g012450	cytochrome P450 CYP749A22-like	17474071	17475523	-	Cytochrome 450	p450 (E=1.2e-20)
Pdr6g012460	beta-glucosidase 13-like	17478457	17482603	+	Other genes	n/a
Pdr6g012470	mitochondrial pyruvate carrier 1-like	17484388	17485041	+	Other genes	n/a
Pdr6g012480	WD repeat-containing protein 74-like	17485598	17490648	-	Other genes	n/a
Pdr6g012490	4-coumarate--CoA ligase-like 9	17494375	17497196	+	CoA-ligase	AMP-binding (E=8.5e-69)
Pdr6g012500	cyclin-dependent kinase G-2-like	17501816	17503723	-	Other genes	n/a
Pdr6g012510	malate synthase	17506099	17509525	+	Other genes	n/a
Pdr6g012520	hypothetical protein	17516616	17517538	-	Other genes	n/a
Pdr6g012530	receptor-like serine/threonine-protein kinase SD1-8	17534048	17534248	+	Other genes	n/a
Pdr6g012540	transcription factor GTE10-like	17539487	17544269	+	Other genes	n/a
Pdr6g012550	3-oxoacyl-[acyl-carrier-protein] reductase 4-like	17545562	17547182	+	Oxidoreductase	adh_short (E=3.3e-20)
Pdr6g012560	flavonol 4'-sulfotransferase-like	17556488	17557678	-	Other genes	n/a

Show:

biosynthetic genesother genes

Legend:

Cytochrome 450

Terpene synthase

Copper amine oxidase

Pictet-Spengler enzyme (Bet v1)

Glycosyltransferase

Ketosynthase

Squalene epoxidase

COesterase

Methyltransferase

BAHD acyltransferase

Scl acyltransferase

Epimerase

Oxidoreductase

Dioxygenase

Transporter

CoA-ligase

Amino oxidase

Aminotransferase

Prenyltransferase

Strictosidine synthase-like

PRISE enzymes

Dirigent enzymes

Cellulose synthase-like

Fatty acid desaturase

Lipoxygenase

Polyprenyl synthetase

(Other) Biosynthetic Genes

Other Genes

biosynthetic genes

transport-related genes

regulatory genes

other genes

Chr6 - Cluster 30 - Cyclopeptide

Gene cluster description

Download cluster GenBank file

Chr6 - Gene Cluster 30. Type = cyclopeptide. Location: 18724724 - 19046055 nt. Click on genes for more information.

Show pHMM detection rules used

plants/cyclopeptide: (BURP)

Genes:

Locus tag	Functional annotation	From	To	Strand	Category	Domains
Pdr6g014100	pantothenate kinase 2-like	18725652	18732993	+	Other genes	n/a
Pdr6g014110	serine/threonine-protein kinase ATM-like	18735470	18739156	+	Other genes	n/a
Pdr6g014120	50S ribosomal protein L12	18739910	18740491	-	Other genes	n/a
Pdr6g014130	dof zinc finger protein DOF5.6-like	18742666	18744284	-	Other genes	n/a
Pdr6g014140	serine/threonine-protein kinase ATM	18754158	18781505	+	Other genes	n/a
Pdr6g014150	inactive poly [ADP-ribose] polymerase SRO5	18785507	18787444	+	Other genes	n/a
Pdr6g014160	hypothetical protein	18795156	18796070	+	Other genes	n/a
Pdr6g014170	1-deoxy-D-xylulose 5-phosphate reductoisomerase	18806803	18810930	-	Other genes	n/a
Pdr6g014180	peroxisomal membrane protein PEX14-like	18815061	18818946	-	Other genes	n/a
Pdr6g014190	transcription factor WER-like	18827242	18828945	-	Other genes	n/a
Pdr6g014200	exosome complex component rrp40	18831509	18835983	-	Other genes	n/a
Pdr6g014210	pentatricopeptide repeat-containing protein	18836276	18838902	+	Other genes	n/a
Pdr6g014220	hypothetical protein	18841468	18844047	-	Other genes	n/a
Pdr6g014230	serine/threonine-protein kinase HT1-like	18852324	18855353	-	Other genes	n/a
Pdr6g014240	CASP-like protein	18863662	18865249	-	Other genes	n/a
Pdr6g014250	protein EXECUTER 1	18867294	18872711	-	Other genes	n/a
Pdr6g014260	E3 ubiquitin-protein ligase SIS3-like	18874671	18880252	-	Other genes	n/a
Pdr6g014270	polygalacturonase non-catalytic subunit JP650	18884377	18886402	+	(Other) biosynthetic genes	BURP (E=3.1e-63)
Pdr6g014280	hypothetical protein	18887863	18888722	+	Other genes	n/a
Pdr6g014290	hypothetical protein	18904198	18909196	+	Other genes	n/a
Pdr6g014300	hypothetical protein	18918525	18923033	+	Other genes	n/a
Pdr6g014310	serine/threonine-protein kinase HT1-like	18942257	18945546	+	Other genes	n/a
Pdr6g014320	bidirectional sugar transporter SWEET5-like	18948116	18950060	-	Other genes	n/a
Pdr6g014330	RING-H2 finger protein ATL64-like	18954964	18955407	+	Other genes	n/a
Pdr6g014340	26S proteasome complex subunit sem1-1	18956509	18957312	-	Other genes	n/a
Pdr6g014350	U-box domain-containing protein 19-like	18958316	18960379	-	Other genes	n/a
Pdr6g014360	aldehyde dehydrogenase family 2 member B4	18962786	18965736	-	Other genes	n/a
Pdr6g014370	cyclic nucleotide-gated ion channel 16	18970322	18973999	-	Other genes	n/a
Pdr6g014380	spermidine synthase 2-like	18983228	18987111	+	Other genes	n/a
Pdr6g014390	hypothetical protein	18989170	18990884	-	Other genes	n/a
Pdr6g014400	alpha	19004198	19006996	+	Other genes	n/a
Pdr6g014410	hypothetical protein	19011364	19011789	+	Other genes	n/a
Pdr6g014420	hypothetical protein	19018509	19019776	-	Other genes	n/a
Pdr6g014430	RING-H2 finger protein ATL46-like	19023779	19024849	-	Other genes	n/a
Pdr6g014440	inactive receptor kinase	19027335	19036878	-	Other genes	n/a
Pdr6g014450	WAT1-related protein	19040041	19042825	+	Other genes	n/a
Pdr6g014460	protease Do-like 9	19043368	19047120	-	Other genes	n/a

Show:

biosynthetic genesother genes

Legend:

Cytochrome 450

Terpene synthase

Copper amine oxidase

Pictet-Spengler enzyme (Bet v1)

Glycosyltransferase

Ketosynthase

Squalene epoxidase

COesterase

Methyltransferase

BAHD acyltransferase

Scl acyltransferase

Epimerase

Oxidoreductase

Dioxygenase

Transporter

CoA-ligase

Amino oxidase

Aminotransferase

Prenyltransferase

Strictosidine synthase-like

PRISE enzymes

Dirigent enzymes

Cellulose synthase-like

Fatty acid desaturase

Lipoxygenase

Polyprenyl synthetase

(Other) Biosynthetic Genes

Other Genes

biosynthetic genes

transport-related genes

regulatory genes

other genes

Chr7 - Cluster 31 - Putative

Gene cluster description

Download cluster GenBank file

Chr7 - Gene Cluster 31. Type = putative. Location: 6163058 - 6384414 nt. Click on genes for more information.

Show pHMM detection rules used

plants/plant: (minimum(4,[cMT,nMT,oMT,adh_short,Chal_sti_synt_C,Chal_sti_synt_N,COesterase,UDPGT,Glyco_transf_28,Glycos_transf_1,Glycos_transf_2,Lycopene_cycl,NAD_binding_1,p450,SQHop_cyclase_C,SQHop_cyclase_N,Prenyltrans,Terpene_synth_C,Terpene_synth,Transferase,Aminotran_1_2,AMP-binding,DIOX_N,Dirigent,Bet_v_1,Cu_amine_oxid,Str_synth,Trp_syntA,His_biosynth,adh_short_C2,Peptidase_S10,Prenyltransf,Epimerase,2OG-FeII_Oxy,Aminotran_3,Methyltransf_2,Methyltransf_3,Methyltransf_7,PRISE,Cellulose_synt,Chalcone,ERG4_ERG24,FA_desaturase,FA_desaturase_2,Methyltransf_11,polyprenyl_synt,SE,SQS_PSY,TPMT,UbiA,Lipoxygenase,Lyase_aromatic,HMGL-like,Chalcone_3,Chalcone_2,Acetyltransf_1,UDPGT_2,GMC_oxred_N,GMC_oxred_C,Amino_oxidase,DAHP_synth_1,DAHP_synth_2], []))

Genes:

Locus tag	Functional annotation	From	To	Strand	Category	Domains
Pdr7g006090	cytochrome P450 714C2-like	6179758	6188307	-	Cytochrome 450	p450 (E=2.5e-38)
Pdr7g006100	salutaridinol 7-O-acetyltransferase-like	6201840	6203273	-	BAHD acyltransferase	Transferase (E=8.1e-72)
Pdr7g006110	hypothetical protein	6220426	6224463	+	Other genes	n/a
Pdr7g006120	hypothetical protein	6225266	6227742	+	Other genes	n/a
Pdr7g006130	hypothetical protein	6231439	6233463	+	Other genes	n/a
Pdr7g006140	BAHD acyltransferase	6264746	6267844	-	BAHD acyltransferase	Transferase (E=4.4e-76)
Pdr7g006150	S2-RNase	6320102	6320995	-	Other genes	n/a
Pdr7g006160	BAHD acyltransferase	6324453	6325886	-	BAHD acyltransferase	Transferase (E=1e-70)
Pdr7g006170	cytochrome P450 714C2-like	6336997	6342355	-	Cytochrome 450	p450 (E=3.5e-13)
Pdr7g006180	hypothetical protein	6345501	6345899	+	Other genes	n/a
Pdr7g006190	cytochrome P450 714C2-like	6356117	6356560	+	Other genes	n/a
Pdr7g006200	cytochrome P450 714C2-like	6365150	6367714	-	Cytochrome 450	p450 (E=4.9e-37)
Pdr7g006210	casein kinase II subunit beta-4	6376940	6380157	+	Other genes	n/a

Show:

biosynthetic genesother genes

Legend:

Cytochrome 450

Terpene synthase

Copper amine oxidase

Pictet-Spengler enzyme (Bet v1)

Glycosyltransferase

Ketosynthase

Squalene epoxidase

COesterase

Methyltransferase

BAHD acyltransferase

Scl acyltransferase

Epimerase

Oxidoreductase

Dioxygenase

Transporter

CoA-ligase

Amino oxidase

Aminotransferase

Prenyltransferase

Strictosidine synthase-like

PRISE enzymes

Dirigent enzymes

Cellulose synthase-like

Fatty acid desaturase

Lipoxygenase

Polyprenyl synthetase

(Other) Biosynthetic Genes

Other Genes

biosynthetic genes

transport-related genes

regulatory genes

other genes

Chr7 - Cluster 32 - Saccharide

Gene cluster description

Download cluster GenBank file

Chr7 - Gene Cluster 32. Type = saccharide. Location: 14931204 - 15206256 nt. Click on genes for more information.

Show pHMM detection rules used

plants/plant: (minimum(4,[cMT,nMT,oMT,adh_short,Chal_sti_synt_C,Chal_sti_synt_N,COesterase,UDPGT,Glyco_transf_28,Glycos_transf_1,Glycos_transf_2,Lycopene_cycl,NAD_binding_1,p450,SQHop_cyclase_C,SQHop_cyclase_N,Prenyltrans,Terpene_synth_C,Terpene_synth,Transferase,Aminotran_1_2,AMP-binding,DIOX_N,Dirigent,Bet_v_1,Cu_amine_oxid,Str_synth,Trp_syntA,His_biosynth,adh_short_C2,Peptidase_S10,Prenyltransf,Epimerase,2OG-FeII_Oxy,Aminotran_3,Methyltransf_2,Methyltransf_3,Methyltransf_7,PRISE,Cellulose_synt,Chalcone,ERG4_ERG24,FA_desaturase,FA_desaturase_2,Methyltransf_11,polyprenyl_synt,SE,SQS_PSY,TPMT,UbiA,Lipoxygenase,Lyase_aromatic,HMGL-like,Chalcone_3,Chalcone_2,Acetyltransf_1,UDPGT_2,GMC_oxred_N,GMC_oxred_C,Amino_oxidase,DAHP_synth_1,DAHP_synth_2], []))
plants/saccharide: (minimum(3,[cMT,nMT,oMT,adh_short,Chal_sti_synt_C,Chal_sti_synt_N,COesterase,UDPGT,Glyco_transf_28,Glycos_transf_1,Glycos_transf_2,Lycopene_cycl,NAD_binding_1,p450,SQHop_cyclase_C,SQHop_cyclase_N,Prenyltrans,Terpene_synth_C,Terpene_synth,Transferase,Aminotran_1_2,AMP-binding,DIOX_N,Dirigent,Bet_v_1,Cu_amine_oxid,Str_synth,Trp_syntA,His_biosynth,adh_short_C2,Peptidase_S10,Prenyltransf,Epimerase,2OG-FeII_Oxy,Aminotran_3,Methyltransf_2,Methyltransf_3,Methyltransf_7,PRISE,Cellulose_synt,Chalcone,ERG4_ERG24,FA_desaturase,FA_desaturase_2,Methyltransf_11,polyprenyl_synt,SE,SQS_PSY,TPMT,UbiA,Lipoxygenase,Lyase_aromatic,HMGL-like,Chalcone_3,Chalcone_2,Acetyltransf_1,UDPGT_2,GMC_oxred_N,GMC_oxred_C,Amino_oxidase,DAHP_synth_1,DAHP_synth_2], [Glycos_transf_1/Glycos_transf_2/Glycos_transf_28/UDPGT/UDPGT_2]))

Genes:

Locus tag	Functional annotation	From	To	Strand	Category	Domains
Pdr7g010130	hypothetical protein	14932153	14932686	+	Other genes	n/a
Pdr7g010140	dimethyladenosine transferase	14936447	14939453	-	Other genes	n/a
Pdr7g010150	hypothetical protein	14948529	14951776	+	Epimerase	Epimerase (E=2.2e-07)
Pdr7g010160	hypothetical protein	14952895	14956296	+	Other genes	n/a
Pdr7g010170	NAD-dependent malic enzyme 59 kDa	14960513	14966404	+	Other genes	n/a
Pdr7g010180	(+)-neomenthol dehydrogenase-like	15021216	15022649	+	Oxidoreductase	adh_short_C2 (E=3.4e-07)
Pdr7g010190	(+)-neomenthol dehydrogenase-like	15036418	15037851	+	Oxidoreductase	adh_short_C2 (E=1.9e-07)
Pdr7g010200	(+)-neomenthol dehydrogenase-like	15046658	15051156	+	Oxidoreductase	adh_short_C2 (E=3.7e-07)
Pdr7g010210	acidic endochitinase-like	15057643	15058548	+	Other genes	n/a
Pdr7g010220	rRNA-processing protein FCF1-like protein	15062655	15065404	-	Other genes	n/a
Pdr7g010230	hypothetical protein	15066868	15067266	-	Other genes	n/a
Pdr7g010240	aluminum-activated malate transporter 9-like	15082165	15082806	-	Other genes	n/a
Pdr7g010250	hypothetical protein	15092363	15100500	-	Glycosyltransferase	Glycos_transf_1 (E=8.9e-09)
Pdr7g010260	hypothetical protein	15107267	15107542	+	Other genes	n/a
Pdr7g010270	hypothetical protein	15111847	15116064	-	Other genes	n/a
Pdr7g010280	UDP-D-xylose:L-fucose alpha-1	15120485	15122926	-	Other genes	n/a
Pdr7g010290	protein ABIL1-like	15123809	15126167	-	Other genes	n/a
Pdr7g010300	delta(8)-fatty-acid desaturase 1-like	15141473	15142822	+	Fatty acid desaturase	FA_desaturase (E=1.9e-35)
Pdr7g010310	hypothetical protein	15176482	15177379	-	Other genes	n/a
Pdr7g010320	delta(8)-fatty-acid desaturase 1-like	15187588	15188931	+	Fatty acid desaturase	FA_desaturase (E=1e-35)
Pdr7g010330	U11/U12 small nuclear ribonucleoprotein 59 kDa protein	15190901	15193133	+	Other genes	n/a
Pdr7g010340	hypothetical protein	15199599	15201380	+	Other genes	n/a

Show:

biosynthetic genesother genes

Legend:

Cytochrome 450

Terpene synthase

Copper amine oxidase

Pictet-Spengler enzyme (Bet v1)

Glycosyltransferase

Ketosynthase

Squalene epoxidase

COesterase

Methyltransferase

BAHD acyltransferase

Scl acyltransferase

Epimerase

Oxidoreductase

Dioxygenase

Transporter

CoA-ligase

Amino oxidase

Aminotransferase

Prenyltransferase

Strictosidine synthase-like

PRISE enzymes

Dirigent enzymes

Cellulose synthase-like

Fatty acid desaturase

Lipoxygenase

Polyprenyl synthetase

(Other) Biosynthetic Genes

Other Genes

biosynthetic genes

transport-related genes

regulatory genes

other genes

Chr8 - Cluster 33 - Saccharide

Gene cluster description

Download cluster GenBank file

Chr8 - Gene Cluster 33. Type = saccharide. Location: 389675 - 468160 nt. Click on genes for more information.

Show pHMM detection rules used

plants/saccharide: (minimum(3,[cMT,nMT,oMT,adh_short,Chal_sti_synt_C,Chal_sti_synt_N,COesterase,UDPGT,Glyco_transf_28,Glycos_transf_1,Glycos_transf_2,Lycopene_cycl,NAD_binding_1,p450,SQHop_cyclase_C,SQHop_cyclase_N,Prenyltrans,Terpene_synth_C,Terpene_synth,Transferase,Aminotran_1_2,AMP-binding,DIOX_N,Dirigent,Bet_v_1,Cu_amine_oxid,Str_synth,Trp_syntA,His_biosynth,adh_short_C2,Peptidase_S10,Prenyltransf,Epimerase,2OG-FeII_Oxy,Aminotran_3,Methyltransf_2,Methyltransf_3,Methyltransf_7,PRISE,Cellulose_synt,Chalcone,ERG4_ERG24,FA_desaturase,FA_desaturase_2,Methyltransf_11,polyprenyl_synt,SE,SQS_PSY,TPMT,UbiA,Lipoxygenase,Lyase_aromatic,HMGL-like,Chalcone_3,Chalcone_2,Acetyltransf_1,UDPGT_2,GMC_oxred_N,GMC_oxred_C,Amino_oxidase,DAHP_synth_1,DAHP_synth_2], [Glycos_transf_1/Glycos_transf_2/Glycos_transf_28/UDPGT/UDPGT_2]))

Genes:

Locus tag	Functional annotation	From	To	Strand	Category	Domains
Pdr8g000520	protein YLS9-like	392766	393029	-	Other genes	n/a
Pdr8g000530	transcription factor bHLH74-like	399318	401395	+	Other genes	n/a
Pdr8g000540	xyloglucan glycosyltransferase 12	403427	406015	-	Glycosyltransferase	Glycos_transf_2 (E=6e-15)
Pdr8g000550	hypothetical protein	420007	421500	-	Other genes	n/a
Pdr8g000560	squalene monooxygenase-like	428986	432738	+	Squalene epoxidase	SE (E=4.1e-106)
Pdr8g000570	hypothetical protein	433870	436293	-	Other genes	n/a
Pdr8g000580	1-aminocyclopropane-1-carboxylate synthase 8-like	452179	454408	+	Aminotransferase	Aminotran_1_2 (E=2.5e-17)
Pdr8g000590	proline-rich protein 12-like	464469	469146	+	Other genes	n/a

Show:

biosynthetic genesother genes

Legend:

Cytochrome 450

Terpene synthase

Copper amine oxidase

Pictet-Spengler enzyme (Bet v1)

Glycosyltransferase

Ketosynthase

Squalene epoxidase

COesterase

Methyltransferase

BAHD acyltransferase

Scl acyltransferase

Epimerase

Oxidoreductase

Dioxygenase

Transporter

CoA-ligase

Amino oxidase

Aminotransferase

Prenyltransferase

Strictosidine synthase-like

PRISE enzymes

Dirigent enzymes

Cellulose synthase-like

Fatty acid desaturase

Lipoxygenase

Polyprenyl synthetase

(Other) Biosynthetic Genes

Other Genes

biosynthetic genes

transport-related genes

regulatory genes

other genes

Chr8 - Cluster 34 - Saccharide

Gene cluster description

Download cluster GenBank file

Chr8 - Gene Cluster 34. Type = saccharide. Location: 659963 - 737092 nt. Click on genes for more information.

Show pHMM detection rules used

plants/saccharide: (minimum(3,[cMT,nMT,oMT,adh_short,Chal_sti_synt_C,Chal_sti_synt_N,COesterase,UDPGT,Glyco_transf_28,Glycos_transf_1,Glycos_transf_2,Lycopene_cycl,NAD_binding_1,p450,SQHop_cyclase_C,SQHop_cyclase_N,Prenyltrans,Terpene_synth_C,Terpene_synth,Transferase,Aminotran_1_2,AMP-binding,DIOX_N,Dirigent,Bet_v_1,Cu_amine_oxid,Str_synth,Trp_syntA,His_biosynth,adh_short_C2,Peptidase_S10,Prenyltransf,Epimerase,2OG-FeII_Oxy,Aminotran_3,Methyltransf_2,Methyltransf_3,Methyltransf_7,PRISE,Cellulose_synt,Chalcone,ERG4_ERG24,FA_desaturase,FA_desaturase_2,Methyltransf_11,polyprenyl_synt,SE,SQS_PSY,TPMT,UbiA,Lipoxygenase,Lyase_aromatic,HMGL-like,Chalcone_3,Chalcone_2,Acetyltransf_1,UDPGT_2,GMC_oxred_N,GMC_oxred_C,Amino_oxidase,DAHP_synth_1,DAHP_synth_2], [Glycos_transf_1/Glycos_transf_2/Glycos_transf_28/UDPGT/UDPGT_2]))

Genes:

Locus tag	Functional annotation	From	To	Strand	Category	Domains
Pdr8g000770	transport protein SEC23-like	662078	662425	+	Other genes	n/a
Pdr8g000780	protein EARLY FLOWERING 3-like	663409	664343	+	Other genes	n/a
Pdr8g000790	transcription factor bHLH74-like	665787	667866	+	Other genes	n/a
Pdr8g000800	xyloglucan glycosyltransferase 12	669868	671862	-	Glycosyltransferase	Glycos_transf_2 (E=4.1e-12)
Pdr8g000810	hypothetical protein	684783	686276	-	Other genes	n/a
Pdr8g000820	squalene monooxygenase-like	694791	698542	+	Squalene epoxidase	SE (E=2.7e-106)
Pdr8g000830	hypothetical protein	699665	702095	-	Other genes	n/a
Pdr8g000840	1-aminocyclopropane-1-carboxylate synthase 8-like	718333	727187	+	Aminotransferase	Aminotran_1_2 (E=6e-17)
Pdr8g000850	hypothetical protein	728753	728914	-	Other genes	n/a
Pdr8g000860	CSC1-like protein RXW8	733009	737822	+	Other genes	n/a

Show:

biosynthetic genesother genes

Legend:

Cytochrome 450

Terpene synthase

Copper amine oxidase

Pictet-Spengler enzyme (Bet v1)

Glycosyltransferase

Ketosynthase

Squalene epoxidase

COesterase

Methyltransferase

BAHD acyltransferase

Scl acyltransferase

Epimerase

Oxidoreductase

Dioxygenase

Transporter

CoA-ligase

Amino oxidase

Aminotransferase

Prenyltransferase

Strictosidine synthase-like

PRISE enzymes

Dirigent enzymes

Cellulose synthase-like

Fatty acid desaturase

Lipoxygenase

Polyprenyl synthetase

(Other) Biosynthetic Genes

Other Genes

biosynthetic genes

transport-related genes

regulatory genes

other genes

Chr8 - Cluster 35 - Polyketide

Gene cluster description

Download cluster GenBank file

Chr8 - Gene Cluster 35. Type = polyketide. Location: 6188712 - 6269725 nt. Click on genes for more information.

Show pHMM detection rules used

plants/polyketide: (minimum(3,[cMT,nMT,oMT,adh_short,Chal_sti_synt_C,Chal_sti_synt_N,COesterase,UDPGT,Glyco_transf_28,Glycos_transf_1,Glycos_transf_2,Lycopene_cycl,NAD_binding_1,p450,SQHop_cyclase_C,SQHop_cyclase_N,Prenyltrans,Terpene_synth_C,Terpene_synth,Transferase,Aminotran_1_2,AMP-binding,DIOX_N,Dirigent,Bet_v_1,Cu_amine_oxid,Str_synth,Trp_syntA,His_biosynth,adh_short_C2,Peptidase_S10,Prenyltransf,Epimerase,2OG-FeII_Oxy,Aminotran_3,Methyltransf_2,Methyltransf_3,Methyltransf_7,PRISE,Cellulose_synt,Chalcone,ERG4_ERG24,FA_desaturase,FA_desaturase_2,Methyltransf_11,polyprenyl_synt,SE,SQS_PSY,TPMT,UbiA,Lipoxygenase,Lyase_aromatic,HMGL-like,Chalcone_3,Chalcone_2,Acetyltransf_1,UDPGT_2,GMC_oxred_N,GMC_oxred_C,Amino_oxidase,DAHP_synth_1,DAHP_synth_2], [Chal_sti_synt_C/Chal_sti_synt_N]))

Genes:

Locus tag	Functional annotation	From	To	Strand	Category	Domains
Pdr8g007590	proline-rich receptor-like protein kinase PERK6	6182450	6189662	+	Other genes	n/a
Pdr8g007600	vestitone reductase-like	6198625	6199233	+	Epimerase	Epimerase (E=7.7e-13)
Pdr8g007610	vestitone reductase-like	6209649	6211721	+	Epimerase	Epimerase (E=1.3e-05)
Pdr8g007620	hypothetical protein	6213805	6217164	-	Other genes	n/a
Pdr8g007630	peroxidase N1-like	6221983	6223099	-	Other genes	n/a
Pdr8g007640	peroxidase N1-like	6233612	6234729	-	Other genes	n/a
Pdr8g007650	peroxidase N1-like	6245163	6247411	+	Other genes	n/a
Pdr8g007660	peroxidase N1-like	6250272	6251450	+	Other genes	n/a
Pdr8g007670	54S ribosomal protein L51	6253252	6254822	-	Other genes	n/a
Pdr8g007680	3-ketoacyl-CoA synthase 7-like	6256059	6259812	+	Ketosynthase	Chal_sti_synt_N (E=0.00013)
Pdr8g007690	phosphatidylinositol 4-phosphate 5-kinase 8-like	6264445	6287628	+	Other genes	n/a

Show:

biosynthetic genesother genes

Legend:

Cytochrome 450

Terpene synthase

Copper amine oxidase

Pictet-Spengler enzyme (Bet v1)

Glycosyltransferase

Ketosynthase

Squalene epoxidase

COesterase

Methyltransferase

BAHD acyltransferase

Scl acyltransferase

Epimerase

Oxidoreductase

Dioxygenase

Transporter

CoA-ligase

Amino oxidase

Aminotransferase

Prenyltransferase

Strictosidine synthase-like

PRISE enzymes

Dirigent enzymes

Cellulose synthase-like

Fatty acid desaturase

Lipoxygenase

Polyprenyl synthetase

(Other) Biosynthetic Genes

Other Genes

biosynthetic genes

transport-related genes

regulatory genes

other genes

Chr8 - Cluster 36 - Cyclopeptide

Gene cluster description

Download cluster GenBank file

Chr8 - Gene Cluster 36. Type = cyclopeptide. Location: 10058614 - 10483929 nt. Click on genes for more information.

Show pHMM detection rules used

plants/cyclopeptide: (BURP)

Genes:

Locus tag	Functional annotation	From	To	Strand	Category	Domains
Pdr8g011400	rhomboid protein 1	10084528	10086230	-	Other genes	n/a
Pdr8g011410	MADS-box protein AGL24-like	10099267	10109478	-	Other genes	n/a
Pdr8g011420	hypothetical protein	10122827	10123756	+	Other genes	n/a
Pdr8g011430	beta carbonic anhydrase 5	10133148	10138550	+	Other genes	n/a
Pdr8g011440	AP-4 complex subunit mu	10141321	10147876	+	Other genes	n/a
Pdr8g011450	zinc finger CCCH domain-containing protein 14-like	10153434	10153783	-	Other genes	n/a
Pdr8g011460	DNA-binding protein ESCAROLA	10158041	10159009	+	Other genes	n/a
Pdr8g011470	ubiquitin carboxyl-terminal hydrolase 16-like	10172691	10179387	-	Other genes	n/a
Pdr8g011480	eukaryotic translation initiation factor 3 subunit C-like	10191073	10194867	+	Other genes	n/a
Pdr8g011490	aspartic proteinase nepenthesin-1-like	10209070	10210398	+	Other genes	n/a
Pdr8g011500	hypothetical protein	10214769	10216007	-	Other genes	n/a
Pdr8g011510	pectin methylesterase 3	10216454	10219399	-	Other genes	n/a
Pdr8g011520	mitochondrial uncoupling protein 5-like	10241455	10242408	+	Other genes	n/a
Pdr8g011530	rho GTPase-activating protein REN1-like	10243138	10252638	-	Other genes	n/a
Pdr8g011540	dehydration-responsive protein RD22-like	10261400	10262844	-	Other genes	n/a
Pdr8g011550	dehydration-responsive protein RD22-like	10271119	10271424	-	(Other) biosynthetic genes	BURP (E=6.1e-33)
Pdr8g011560	BURP domain-containing protein 3-like	10277456	10278226	-	Other genes	n/a
Pdr8g011570	hypothetical protein	10282473	10285575	+	Other genes	n/a
Pdr8g011580	phosphoribosylformylglycinamidine cyclo-ligase	10288503	10290574	+	Other genes	n/a
Pdr8g011590	malate dehydrogenase	10291347	10292192	-	Other genes	n/a
Pdr8g011600	hypothetical protein	10314335	10316634	+	Other genes	n/a
Pdr8g011610	phosphoribosylformylglycinamidine cyclo-ligase	10320618	10322710	+	Other genes	n/a
Pdr8g011620	hypothetical protein	10323252	10343956	-	Other genes	n/a
Pdr8g011630	protein tumorous imaginal discs	10359529	10362253	+	Other genes	n/a
Pdr8g011640	protein CutA	10367548	10370204	-	Other genes	n/a
Pdr8g011650	F-box/LRR-repeat protein 13-like	10371496	10372164	+	Other genes	n/a
Pdr8g011660	FBD-associated F-box protein	10372186	10373843	+	Other genes	n/a
Pdr8g011670	cyclin-D2-1-like	10387774	10389994	+	Other genes	n/a
Pdr8g011680	transcription factor bHLH143-like	10414331	10414631	+	Other genes	n/a
Pdr8g011690	transcription factor bHLH143-like	10414869	10415930	+	Other genes	n/a
Pdr8g011700	WD and tetratricopeptide repeats protein 1-like	10418028	10428843	+	Other genes	n/a
Pdr8g011710	hypothetical protein	10444779	10445457	+	Other genes	n/a
Pdr8g011720	serine/threonine-protein kinase-like protein	10481637	10483193	+	Other genes	n/a

Show:

biosynthetic genesother genes

Legend:

Cytochrome 450

Terpene synthase

Copper amine oxidase

Pictet-Spengler enzyme (Bet v1)

Glycosyltransferase

Ketosynthase

Squalene epoxidase

COesterase

Methyltransferase

BAHD acyltransferase

Scl acyltransferase

Epimerase

Oxidoreductase

Dioxygenase

Transporter

CoA-ligase

Amino oxidase

Aminotransferase

Prenyltransferase

Strictosidine synthase-like

PRISE enzymes

Dirigent enzymes

Cellulose synthase-like

Fatty acid desaturase

Lipoxygenase

Polyprenyl synthetase

(Other) Biosynthetic Genes

Other Genes

biosynthetic genes

transport-related genes

regulatory genes

other genes

Chr8 - Cluster 37 - Saccharide

Gene cluster description

Download cluster GenBank file

Chr8 - Gene Cluster 37. Type = saccharide. Location: 11803338 - 12055228 nt. Click on genes for more information.

Show pHMM detection rules used

plants/saccharide: (minimum(3,[cMT,nMT,oMT,adh_short,Chal_sti_synt_C,Chal_sti_synt_N,COesterase,UDPGT,Glyco_transf_28,Glycos_transf_1,Glycos_transf_2,Lycopene_cycl,NAD_binding_1,p450,SQHop_cyclase_C,SQHop_cyclase_N,Prenyltrans,Terpene_synth_C,Terpene_synth,Transferase,Aminotran_1_2,AMP-binding,DIOX_N,Dirigent,Bet_v_1,Cu_amine_oxid,Str_synth,Trp_syntA,His_biosynth,adh_short_C2,Peptidase_S10,Prenyltransf,Epimerase,2OG-FeII_Oxy,Aminotran_3,Methyltransf_2,Methyltransf_3,Methyltransf_7,PRISE,Cellulose_synt,Chalcone,ERG4_ERG24,FA_desaturase,FA_desaturase_2,Methyltransf_11,polyprenyl_synt,SE,SQS_PSY,TPMT,UbiA,Lipoxygenase,Lyase_aromatic,HMGL-like,Chalcone_3,Chalcone_2,Acetyltransf_1,UDPGT_2,GMC_oxred_N,GMC_oxred_C,Amino_oxidase,DAHP_synth_1,DAHP_synth_2], [Glycos_transf_1/Glycos_transf_2/Glycos_transf_28/UDPGT/UDPGT_2]))

Genes:

Locus tag	Functional annotation	From	To	Strand	Category	Domains
Pdr8g012680	hypothetical protein	11814699	11814947	+	Other genes	n/a
Pdr8g012690	phospho-2-dehydro-3-deoxyheptonate aldolase 1	11825767	11829315	+	(Other) biosynthetic genes	DAHP_synth_2 (E=2.7e-76)
Pdr8g012700	F-box protein	11835757	11842961	+	Other genes	n/a
Pdr8g012710	S ribonuclease	11850425	11851045	-	Other genes	n/a
Pdr8g012720	7-deoxyloganetin glucosyltransferase-like	11858448	11860144	-	Glycosyltransferase	UDPGT_2 (E=1.3e-22)
Pdr8g012730	7-deoxyloganetin glucosyltransferase-like	11881383	11882994	+	Glycosyltransferase	UDPGT_2 (E=7.6e-33)
Pdr8g012740	7-deoxyloganetin glucosyltransferase-like	11915543	11920823	-	Glycosyltransferase	UDPGT_2 (E=1.4e-31)
Pdr8g012750	hypothetical protein	11941879	11944354	+	Other genes	n/a
Pdr8g012760	UDP-glycosyltransferase 85A2-like	11972183	11975462	+	Glycosyltransferase	UDPGT_2 (E=2.3e-24)
Pdr8g012770	7-deoxyloganetin glucosyltransferase-like	11989013	11996337	+	Glycosyltransferase	UDPGT_2 (E=2e-29)
Pdr8g012780	7-deoxyloganetin glucosyltransferase-like	12002398	12003967	+	Glycosyltransferase	UDPGT_2 (E=2.2e-30)
Pdr8g012790	7-deoxyloganetin glucosyltransferase-like	12010579	12012148	+	Glycosyltransferase	UDPGT_2 (E=2.2e-30)
Pdr8g012800	hypothetical protein	12021668	12021991	+	Other genes	n/a
Pdr8g012810	hypothetical protein	12023840	12024115	+	Other genes	n/a
Pdr8g012820	UDP-glycosyltransferase 85A2-like	12031224	12032799	+	Glycosyltransferase	UDPGT_2 (E=9.5e-30)
Pdr8g012830	oligomeric Golgi complex subunit 5-like	12046273	12047051	-	Other genes	n/a

Show:

biosynthetic genesother genes

Legend:

Cytochrome 450

Terpene synthase

Copper amine oxidase

Pictet-Spengler enzyme (Bet v1)

Glycosyltransferase

Ketosynthase

Squalene epoxidase

COesterase

Methyltransferase

BAHD acyltransferase

Scl acyltransferase

Epimerase

Oxidoreductase

Dioxygenase

Transporter

CoA-ligase

Amino oxidase

Aminotransferase

Prenyltransferase

Strictosidine synthase-like

PRISE enzymes

Dirigent enzymes

Cellulose synthase-like

Fatty acid desaturase

Lipoxygenase

Polyprenyl synthetase

(Other) Biosynthetic Genes

Other Genes

biosynthetic genes

transport-related genes

regulatory genes

other genes

Chr8 - Cluster 38 - Cyclopeptide

Gene cluster description

Download cluster GenBank file

Chr8 - Gene Cluster 38. Type = cyclopeptide. Location: 22857196 - 23400314 nt. Click on genes for more information.

Show pHMM detection rules used

plants/cyclopeptide: (BURP)

Genes:

Locus tag	Functional annotation	From	To	Strand	Category	Domains
Pdr8g018970	hypothetical protein	22851426	22865268	-	Other genes	n/a
Pdr8g018980	vignain-like	22866284	22867011	+	Other genes	n/a
Pdr8g018990	exostosin-like 3	22882977	22884002	+	Other genes	n/a
Pdr8g019000	basic leucine zipper 9-like	22893324	22893661	+	Other genes	n/a
Pdr8g019010	basic leucine zipper 9-like	22896571	22902100	+	Other genes	n/a
Pdr8g019020	calmodulin-like protein 3	22903809	22904369	-	Other genes	n/a
Pdr8g019030	hypothetical protein	22906192	22912050	-	Other genes	n/a
Pdr8g019040	hypothetical protein	22920052	22921482	-	Other genes	n/a
Pdr8g019050	DNA polymerase zeta catalytic subunit-like	22937261	22948865	+	Other genes	n/a
Pdr8g019060	hypothetical protein	22956082	22956682	+	Other genes	n/a
Pdr8g019070	S ribonuclease	22957061	22961638	-	Other genes	n/a
Pdr8g019080	hypothetical protein	22962730	22966751	+	Other genes	n/a
Pdr8g019090	hypothetical protein	23014797	23024543	+	Other genes	n/a
Pdr8g019100	hypothetical protein	23029080	23033460	+	Other genes	n/a
Pdr8g019110	NAC domain-containing protein 100-like	23035421	23038052	-	Other genes	n/a
Pdr8g019120	tRNA (guanine-N(7)-)-methyltransferase-like	23049173	23049931	+	Other genes	n/a
Pdr8g019130	hypothetical protein	23053176	23054211	+	Other genes	n/a
Pdr8g019140	pentatricopeptide repeat-containing protein	23055867	23057924	+	Other genes	n/a
Pdr8g019150	pentatricopeptide repeat-containing protein	23059430	23059747	-	Other genes	n/a
Pdr8g019160	pentatricopeptide repeat-containing protein	23064768	23065085	-	Other genes	n/a
Pdr8g019170	hypothetical protein	23069147	23072371	-	Other genes	n/a
Pdr8g019180	hypothetical protein	23075723	23085249	-	Other genes	n/a
Pdr8g019190	helicase and polymerase-containing protein TEBICHI	23096234	23110095	+	Other genes	n/a
Pdr8g019200	hypothetical protein	23113343	23114613	-	Other genes	n/a
Pdr8g019210	BURP domain-containing protein 3-like	23118631	23120046	-	(Other) biosynthetic genes	BURP (E=4.3e-74)
Pdr8g019220	dehydration-responsive protein RD22	23136519	23138879	-	(Other) biosynthetic genes	BURP (E=8e-81)
Pdr8g019230	hypothetical protein	23162818	23163208	+	Other genes	n/a
Pdr8g019240	hypothetical protein	23167344	23167642	-	Other genes	n/a
Pdr8g019250	formin-like protein 6	23167680	23168024	-	Other genes	n/a
Pdr8g019260	hypothetical protein	23184031	23186191	+	Other genes	n/a
Pdr8g019270	U3 small nucleolar RNA-associated protein 20-like	23188799	23189633	+	Other genes	n/a
Pdr8g019280	indole-3-pyruvate monooxygenase YUCCA6-like	23213723	23216290	+	Other genes	n/a
Pdr8g019290	60S ribosomal protein L37-3	23239681	23240167	+	Other genes	n/a
Pdr8g019300	GTP-binding protein	23241565	23243456	-	Other genes	n/a
Pdr8g019310	beta-adaptin-like protein A	23246724	23261917	+	Other genes	n/a
Pdr8g019320	protein SYM1-like	23264103	23265070	-	Other genes	n/a
Pdr8g019330	pentatricopeptide repeat-containing protein	23268729	23270864	+	Other genes	n/a
Pdr8g019340	presenilins-associated rhomboid-like protein	23271596	23273400	-	Other genes	n/a
Pdr8g019350	cytochrome b6	23274089	23274778	-	Other genes	n/a
Pdr8g019360	signal peptide peptidase	23277122	23281725	+	Other genes	n/a
Pdr8g019370	hypothetical protein	23289077	23289388	+	Other genes	n/a
Pdr8g019380	hypothetical protein	23291113	23294576	+	Other genes	n/a
Pdr8g019390	coiled-coil domain-containing protein 25-like	23296863	23299079	+	Other genes	n/a
Pdr8g019400	myb-related protein 3R-1	23316408	23321317	+	Other genes	n/a
Pdr8g019410	aspartate aminotransferase	23322425	23325456	-	Aminotransferase	n/a
Pdr8g019420	aspartate aminotransferase	23338868	23342009	-	Aminotransferase	n/a
Pdr8g019430	eukaryotic translation initiation factor 3 subunit L-like	23345720	23351861	-	Other genes	n/a
Pdr8g019440	hypothetical protein	23352725	23355031	-	Other genes	n/a
Pdr8g019450	TOM1-like protein 1	23360520	23366577	+	Other genes	n/a
Pdr8g019460	protein PEROXIN-4	23368239	23370506	+	Other genes	n/a
Pdr8g019470	hypothetical protein	23370889	23375917	-	Other genes	n/a
Pdr8g019480	protein tesmin/TSO1-like CXC 5	23377312	23381657	-	Other genes	n/a
Pdr8g019490	ubiquitin carboxyl-terminal hydrolase 22-like	23387019	23387333	-	Other genes	n/a
Pdr8g019500	protein EMBRYONIC FLOWER 1-like	23397819	23402900	+	Other genes	n/a

Show:

biosynthetic genesother genes

Legend:

Cytochrome 450

Terpene synthase

Copper amine oxidase

Pictet-Spengler enzyme (Bet v1)

Glycosyltransferase

Ketosynthase

Squalene epoxidase

COesterase

Methyltransferase

BAHD acyltransferase

Scl acyltransferase

Epimerase

Oxidoreductase

Dioxygenase

Transporter

CoA-ligase

Amino oxidase

Aminotransferase

Prenyltransferase

Strictosidine synthase-like

PRISE enzymes

Dirigent enzymes

Cellulose synthase-like

Fatty acid desaturase

Lipoxygenase

Polyprenyl synthetase

(Other) Biosynthetic Genes

Other Genes

biosynthetic genes

transport-related genes

regulatory genes

other genes

Chr8 - Cluster 39 - Cyclopeptide

Gene cluster description

Download cluster GenBank file

Chr8 - Gene Cluster 39. Type = cyclopeptide. Location: 23999577 - 24470208 nt. Click on genes for more information.

Show pHMM detection rules used

plants/cyclopeptide: (BURP)

Genes:

Locus tag	Functional annotation	From	To	Strand	Category	Domains
Pdr8g019990	tetraspanin-19-like	23998578	24000081	+	Other genes	n/a
Pdr8g020000	aspartate aminotransferase	24002802	24005944	+	Aminotransferase	n/a
Pdr8g020010	aspartate aminotransferase	24009584	24012610	+	Aminotransferase	n/a
Pdr8g020020	myb-related protein 3R-1-like	24013952	24018786	-	Other genes	n/a
Pdr8g020030	coiled-coil domain-containing protein 25-like	24025524	24027568	-	Other genes	n/a
Pdr8g020040	hypothetical protein	24029655	24033137	-	Other genes	n/a
Pdr8g020050	signal peptide peptidase	24039793	24044372	-	Other genes	n/a
Pdr8g020060	cytochrome b6 (chloroplast)	24046306	24046945	+	Other genes	n/a
Pdr8g020070	presenilins-associated rhomboid-like protein	24047981	24049783	+	Other genes	n/a
Pdr8g020080	pentatricopeptide repeat-containing protein	24050515	24052650	-	Other genes	n/a
Pdr8g020090	aspartate--tRNA ligase	24055089	24056534	-	Other genes	n/a
Pdr8g020100	protein SYM1-like	24058400	24061164	+	Other genes	n/a
Pdr8g020110	pentatricopeptide repeat-containing protein	24063287	24093035	-	Other genes	n/a
Pdr8g020120	beta-adaptin-like protein A	24094088	24099512	-	Other genes	n/a
Pdr8g020130	GTP-binding protein	24105294	24107189	+	Other genes	n/a
Pdr8g020140	60S ribosomal protein L37-3	24108584	24109088	-	Other genes	n/a
Pdr8g020150	indole-3-pyruvate monooxygenase YUCCA6-like	24132458	24135006	-	Other genes	n/a
Pdr8g020160	formin-like protein 6	24186860	24187204	+	Other genes	n/a
Pdr8g020170	hypothetical protein	24187241	24187539	+	Other genes	n/a
Pdr8g020180	hypothetical protein	24191636	24192026	-	Other genes	n/a
Pdr8g020190	dehydration-responsive protein RD22	24215857	24217686	+	Other genes	n/a
Pdr8g020200	BURP domain-containing protein 3-like	24234185	24235600	+	(Other) biosynthetic genes	BURP (E=1.4e-73)
Pdr8g020210	hypothetical protein	24239141	24240682	+	Other genes	n/a
Pdr8g020220	helicase and polymerase-containing protein TEBICHI	24244324	24258189	-	Other genes	n/a
Pdr8g020230	hypothetical protein	24269217	24279237	+	Other genes	n/a
Pdr8g020240	hypothetical protein	24282585	24285898	+	Other genes	n/a
Pdr8g020250	hypothetical protein	24289012	24292219	+	Other genes	n/a
Pdr8g020260	F-box/kelch-repeat protein	24292405	24293915	+	Other genes	n/a
Pdr8g020270	EPIDERMAL PATTERNING FACTOR-like protein 2	24297564	24298130	+	Other genes	n/a
Pdr8g020280	hypothetical protein	24303196	24303435	-	Other genes	n/a
Pdr8g020290	phospholipase SGR2-like	24307204	24316633	+	Other genes	n/a
Pdr8g020300	hypothetical protein	24326762	24328005	+	Other genes	n/a
Pdr8g020310	extensin-like	24333811	24334646	-	Other genes	n/a
Pdr8g020320	wall-associated receptor kinase-like 16	24339379	24343692	+	Other genes	n/a
Pdr8g020330	wall-associated receptor kinase-like 16	24386142	24388725	+	Other genes	n/a
Pdr8g020340	wall-associated receptor kinase-like 16	24433541	24436127	+	Other genes	n/a
Pdr8g020350	wall-associated receptor kinase-like 16	24449207	24454896	+	Other genes	n/a
Pdr8g020360	wall-associated receptor kinase-like 16	24465363	24467232	+	Other genes	n/a

Show:

biosynthetic genesother genes

Legend:

Cytochrome 450

Terpene synthase

Copper amine oxidase

Pictet-Spengler enzyme (Bet v1)

Glycosyltransferase

Ketosynthase

Squalene epoxidase

COesterase

Methyltransferase

BAHD acyltransferase

Scl acyltransferase

Epimerase

Oxidoreductase

Dioxygenase

Transporter

CoA-ligase

Amino oxidase

Aminotransferase

Prenyltransferase

Strictosidine synthase-like

PRISE enzymes

Dirigent enzymes

Cellulose synthase-like

Fatty acid desaturase

Lipoxygenase

Polyprenyl synthetase

(Other) Biosynthetic Genes

Other Genes

biosynthetic genes

transport-related genes

regulatory genes

other genes

Chr9 - Cluster 40 - Saccharide

Gene cluster description

Download cluster GenBank file

Chr9 - Gene Cluster 40. Type = saccharide. Location: 15542742 - 15687238 nt. Click on genes for more information.

Show pHMM detection rules used

plants/plant: (minimum(4,[cMT,nMT,oMT,adh_short,Chal_sti_synt_C,Chal_sti_synt_N,COesterase,UDPGT,Glyco_transf_28,Glycos_transf_1,Glycos_transf_2,Lycopene_cycl,NAD_binding_1,p450,SQHop_cyclase_C,SQHop_cyclase_N,Prenyltrans,Terpene_synth_C,Terpene_synth,Transferase,Aminotran_1_2,AMP-binding,DIOX_N,Dirigent,Bet_v_1,Cu_amine_oxid,Str_synth,Trp_syntA,His_biosynth,adh_short_C2,Peptidase_S10,Prenyltransf,Epimerase,2OG-FeII_Oxy,Aminotran_3,Methyltransf_2,Methyltransf_3,Methyltransf_7,PRISE,Cellulose_synt,Chalcone,ERG4_ERG24,FA_desaturase,FA_desaturase_2,Methyltransf_11,polyprenyl_synt,SE,SQS_PSY,TPMT,UbiA,Lipoxygenase,Lyase_aromatic,HMGL-like,Chalcone_3,Chalcone_2,Acetyltransf_1,UDPGT_2,GMC_oxred_N,GMC_oxred_C,Amino_oxidase,DAHP_synth_1,DAHP_synth_2], []))
plants/saccharide: (minimum(3,[cMT,nMT,oMT,adh_short,Chal_sti_synt_C,Chal_sti_synt_N,COesterase,UDPGT,Glyco_transf_28,Glycos_transf_1,Glycos_transf_2,Lycopene_cycl,NAD_binding_1,p450,SQHop_cyclase_C,SQHop_cyclase_N,Prenyltrans,Terpene_synth_C,Terpene_synth,Transferase,Aminotran_1_2,AMP-binding,DIOX_N,Dirigent,Bet_v_1,Cu_amine_oxid,Str_synth,Trp_syntA,His_biosynth,adh_short_C2,Peptidase_S10,Prenyltransf,Epimerase,2OG-FeII_Oxy,Aminotran_3,Methyltransf_2,Methyltransf_3,Methyltransf_7,PRISE,Cellulose_synt,Chalcone,ERG4_ERG24,FA_desaturase,FA_desaturase_2,Methyltransf_11,polyprenyl_synt,SE,SQS_PSY,TPMT,UbiA,Lipoxygenase,Lyase_aromatic,HMGL-like,Chalcone_3,Chalcone_2,Acetyltransf_1,UDPGT_2,GMC_oxred_N,GMC_oxred_C,Amino_oxidase,DAHP_synth_1,DAHP_synth_2], [Glycos_transf_1/Glycos_transf_2/Glycos_transf_28/UDPGT/UDPGT_2]))

Genes:

Locus tag	Functional annotation	From	To	Strand	Category	Domains
Pdr9g011580	heat shock 70 kDa protein 17-like	15542884	15548169	+	Other genes	n/a
Pdr9g011590	pentatricopeptide repeat-containing protein	15549043	15551262	+	Other genes	n/a
Pdr9g011600	UDP-arabinose 4-epimerase 2	15551795	15553860	-	Epimerase	Epimerase (E=7.2e-17)
Pdr9g011610	protein PAT1 1-like	15557930	15562930	+	Other genes	n/a
Pdr9g011620	hypothetical protein	15564420	15564839	+	Other genes	n/a
Pdr9g011630	hypothetical protein	15565387	15566053	+	Other genes	n/a
Pdr9g011640	hypothetical protein	15566539	15571981	-	Other genes	n/a
Pdr9g011650	protein TIFY 5A-like	15575504	15576452	-	Other genes	n/a
Pdr9g011660	UDP-glycosyltransferase 85A3-like	15583261	15585255	+	Glycosyltransferase	UDPGT_2 (E=1.7e-26)
Pdr9g011670	7-deoxyloganetin glucosyltransferase-like	15588568	15590123	+	Glycosyltransferase	UDPGT_2 (E=7.1e-27)
Pdr9g011680	7-deoxyloganetin glucosyltransferase-like	15597477	15599037	+	Glycosyltransferase	UDPGT_2 (E=4.5e-23)
Pdr9g011690	hypothetical protein	15601528	15601872	-	Other genes	n/a
Pdr9g011700	UDP-glycosyltransferase 85A3-like	15603481	15605418	+	Glycosyltransferase	UDPGT_2 (E=2.6e-27)
Pdr9g011710	7-deoxyloganetin glucosyltransferase-like	15608479	15623064	+	Glycosyltransferase	UDPGT_2 (E=6.5e-18)
Pdr9g011720	UDP-glycosyltransferase 85A3-like	15625226	15627188	+	Glycosyltransferase	UDPGT_2 (E=4.5e-27)
Pdr9g011730	UDP-glycosyltransferase 85A5-like	15630399	15634311	+	Glycosyltransferase	UDPGT_2 (E=1e-08)
Pdr9g011740	7-deoxyloganetin glucosyltransferase-like	15639210	15640726	+	Glycosyltransferase	UDPGT_2 (E=4.3e-23)
Pdr9g011750	hypothetical protein	15646727	15647970	-	Other genes	n/a
Pdr9g011760	UDP-glycosyltransferase 85A5-like	15652893	15654446	+	Glycosyltransferase	UDPGT_2 (E=9.9e-27)
Pdr9g011770	UDP-glycosyltransferase 85A3-like	15666120	15667784	+	Glycosyltransferase	UDPGT_2 (E=1.4e-24)
Pdr9g011780	UDP-glycosyltransferase 85A2-like	15676524	15678185	+	Glycosyltransferase	UDPGT_2 (E=1.9e-24)
Pdr9g011790	rhodanese-like domain-containing protein 19	15681688	15698429	-	Other genes	n/a

Show:

biosynthetic genesother genes

Legend:

Cytochrome 450

Terpene synthase

Copper amine oxidase

Pictet-Spengler enzyme (Bet v1)

Glycosyltransferase

Ketosynthase

Squalene epoxidase

COesterase

Methyltransferase

BAHD acyltransferase

Scl acyltransferase

Epimerase

Oxidoreductase

Dioxygenase

Transporter

CoA-ligase

Amino oxidase

Aminotransferase

Prenyltransferase

Strictosidine synthase-like

PRISE enzymes

Dirigent enzymes

Cellulose synthase-like

Fatty acid desaturase

Lipoxygenase

Polyprenyl synthetase

(Other) Biosynthetic Genes

Other Genes

biosynthetic genes

transport-related genes

regulatory genes

other genes

contig1145 - Cluster 41 - Alkaloid

Gene cluster description

Download cluster GenBank file

contig1145 - Gene Cluster 41. Type = alkaloid. Location: 62908 - 151075 nt. Click on genes for more information.

Show pHMM detection rules used

plants/alkaloid: (minimum(3,[cMT,nMT,oMT,adh_short,Chal_sti_synt_C,Chal_sti_synt_N,COesterase,UDPGT,Glyco_transf_28,Glycos_transf_1,Glycos_transf_2,Lycopene_cycl,NAD_binding_1,p450,SQHop_cyclase_C,SQHop_cyclase_N,Prenyltrans,Terpene_synth_C,Terpene_synth,Transferase,Aminotran_1_2,AMP-binding,DIOX_N,Dirigent,Bet_v_1,Cu_amine_oxid,Str_synth,Trp_syntA,His_biosynth,adh_short_C2,Peptidase_S10,Prenyltransf,Epimerase,2OG-FeII_Oxy,Aminotran_3,Methyltransf_2,Methyltransf_3,Methyltransf_7,PRISE,Cellulose_synt,Chalcone,ERG4_ERG24,FA_desaturase,FA_desaturase_2,Methyltransf_11,polyprenyl_synt,SE,SQS_PSY,TPMT,UbiA,Lipoxygenase,Lyase_aromatic,HMGL-like,Chalcone_3,Chalcone_2,Acetyltransf_1,UDPGT_2,GMC_oxred_N,GMC_oxred_C,Amino_oxidase,DAHP_synth_1,DAHP_synth_2], [Bet_v_1/Cu_amine_oxid/Str_synth]))

Genes:

Locus tag	Functional annotation	From	To	Strand	Category	Domains
Pdr0g006830	copper amine oxidase 1-like	70794	75716	+	Copper amine oxidase	Cu_amine_oxid (E=5.5e-124)
Pdr0g006840	F-box protein	84523	86445	-	Other genes	n/a
Pdr0g006850	hypothetical protein	93672	95816	-	Other genes	n/a
Pdr0g006860	glutamate--glyoxylate aminotransferase 2-like	97750	101787	-	Aminotransferase	Aminotran_1_2 (E=2.7e-21)
Pdr0g006870	hypothetical protein	102580	102834	-	Other genes	n/a
Pdr0g006880	hypothetical protein	104526	108550	+	Other genes	n/a
Pdr0g006890	protein-tyrosine-phosphatase MKP1-like	109162	111832	-	Other genes	n/a
Pdr0g006900	pentatricopeptide repeat-containing protein	115447	116994	+	Other genes	n/a
Pdr0g006910	hypothetical protein	118942	119994	+	Other genes	n/a
Pdr0g006920	serine/threonine-protein kinase AFC2-like	120518	123909	-	Other genes	n/a
Pdr0g006930	cytochrome P450 71B26-like	141035	143189	+	Cytochrome 450	p450 (E=9.9e-104)
Pdr0g006940	hypothetical protein	146720	149823	-	Other genes	n/a

Show:

biosynthetic genesother genes

Legend:

Cytochrome 450

Terpene synthase

Copper amine oxidase

Pictet-Spengler enzyme (Bet v1)

Glycosyltransferase

Ketosynthase

Squalene epoxidase

COesterase

Methyltransferase

BAHD acyltransferase

Scl acyltransferase

Epimerase

Oxidoreductase

Dioxygenase

Transporter

CoA-ligase

Amino oxidase

Aminotransferase

Prenyltransferase

Strictosidine synthase-like

PRISE enzymes

Dirigent enzymes

Cellulose synthase-like

Fatty acid desaturase

Lipoxygenase

Polyprenyl synthetase

(Other) Biosynthetic Genes

Other Genes

biosynthetic genes

transport-related genes

regulatory genes

other genes

contig1145 - Cluster 42 - Putative

Gene cluster description

Download cluster GenBank file

contig1145 - Gene Cluster 42. Type = putative. Location: 398120 - 491797 nt. Click on genes for more information.

Show pHMM detection rules used

plants/plant: (minimum(4,[cMT,nMT,oMT,adh_short,Chal_sti_synt_C,Chal_sti_synt_N,COesterase,UDPGT,Glyco_transf_28,Glycos_transf_1,Glycos_transf_2,Lycopene_cycl,NAD_binding_1,p450,SQHop_cyclase_C,SQHop_cyclase_N,Prenyltrans,Terpene_synth_C,Terpene_synth,Transferase,Aminotran_1_2,AMP-binding,DIOX_N,Dirigent,Bet_v_1,Cu_amine_oxid,Str_synth,Trp_syntA,His_biosynth,adh_short_C2,Peptidase_S10,Prenyltransf,Epimerase,2OG-FeII_Oxy,Aminotran_3,Methyltransf_2,Methyltransf_3,Methyltransf_7,PRISE,Cellulose_synt,Chalcone,ERG4_ERG24,FA_desaturase,FA_desaturase_2,Methyltransf_11,polyprenyl_synt,SE,SQS_PSY,TPMT,UbiA,Lipoxygenase,Lyase_aromatic,HMGL-like,Chalcone_3,Chalcone_2,Acetyltransf_1,UDPGT_2,GMC_oxred_N,GMC_oxred_C,Amino_oxidase,DAHP_synth_1,DAHP_synth_2], []))

Genes:

Locus tag	Functional annotation	From	To	Strand	Category	Domains
Pdr0g007300	small heat shock protein	397531	398478	+	Other genes	n/a
Pdr0g007310	hypothetical protein	399751	400467	-	Other genes	n/a
Pdr0g007320	hypothetical protein	401812	403646	-	Other genes	n/a
Pdr0g007330	DELLA protein RGL1-like	405032	406579	-	Other genes	n/a
Pdr0g007340	carboxylesterase 11	407574	409363	-	COesterase	COesterase (E=2.1e-05)
Pdr0g007350	vinorine synthase-like	420589	435714	+	Other genes	n/a
Pdr0g007360	vinorine synthase-like	440063	441401	+	BAHD acyltransferase	Transferase (E=5.7e-15)
Pdr0g007370	vinorine synthase-like	461655	463796	+	BAHD acyltransferase	Transferase (E=3.9e-65)
Pdr0g007380	retinoblastoma-related protein-like	466965	468124	-	Other genes	n/a
Pdr0g007390	eukaryotic translation initiation factor 4G	472617	474880	-	Other genes	n/a
Pdr0g007400	vinorine synthase-like	476258	480055	+	BAHD acyltransferase	Transferase (E=6e-78)
Pdr0g007410	BAHD acyltransferase	481042	482343	-	BAHD acyltransferase	Transferase (E=7e-89)
Pdr0g007420	ABC transporter C family member 15	487870	493316	-	Other genes	n/a

Show:

biosynthetic genesother genes

Legend:

Cytochrome 450

Terpene synthase

Copper amine oxidase

Pictet-Spengler enzyme (Bet v1)

Glycosyltransferase

Ketosynthase

Squalene epoxidase

COesterase

Methyltransferase

BAHD acyltransferase

Scl acyltransferase

Epimerase

Oxidoreductase

Dioxygenase

Transporter

CoA-ligase

Amino oxidase

Aminotransferase

Prenyltransferase

Strictosidine synthase-like

PRISE enzymes

Dirigent enzymes

Cellulose synthase-like

Fatty acid desaturase

Lipoxygenase

Polyprenyl synthetase

(Other) Biosynthetic Genes

Other Genes

biosynthetic genes

transport-related genes

regulatory genes

other genes

contig1150 - Cluster 43 - Putative

Gene cluster description

Download cluster GenBank file

contig1150 - Gene Cluster 43. Type = putative. Location: 126675 - 326867 nt. Click on genes for more information.

Show pHMM detection rules used

plants/plant: (minimum(4,[cMT,nMT,oMT,adh_short,Chal_sti_synt_C,Chal_sti_synt_N,COesterase,UDPGT,Glyco_transf_28,Glycos_transf_1,Glycos_transf_2,Lycopene_cycl,NAD_binding_1,p450,SQHop_cyclase_C,SQHop_cyclase_N,Prenyltrans,Terpene_synth_C,Terpene_synth,Transferase,Aminotran_1_2,AMP-binding,DIOX_N,Dirigent,Bet_v_1,Cu_amine_oxid,Str_synth,Trp_syntA,His_biosynth,adh_short_C2,Peptidase_S10,Prenyltransf,Epimerase,2OG-FeII_Oxy,Aminotran_3,Methyltransf_2,Methyltransf_3,Methyltransf_7,PRISE,Cellulose_synt,Chalcone,ERG4_ERG24,FA_desaturase,FA_desaturase_2,Methyltransf_11,polyprenyl_synt,SE,SQS_PSY,TPMT,UbiA,Lipoxygenase,Lyase_aromatic,HMGL-like,Chalcone_3,Chalcone_2,Acetyltransf_1,UDPGT_2,GMC_oxred_N,GMC_oxred_C,Amino_oxidase,DAHP_synth_1,DAHP_synth_2], []))

Genes:

Locus tag	Functional annotation	From	To	Strand	Category	Domains
Pdr0g009320	hypothetical protein	126978	128969	-	Other genes	n/a
Pdr0g009330	UDP-glucuronic acid decarboxylase 1-like	131258	131467	+	Other genes	n/a
Pdr0g009340	hypothetical protein	136905	138663	+	Other genes	n/a
Pdr0g009350	1-aminocyclopropane-1-carboxylate oxidase 1-like	143805	145373	+	Dioxygenase	DIOX_N (E=4.5e-19)
Pdr0g009360	hypothetical protein	149169	149946	+	Other genes	n/a
Pdr0g009370	hypothetical protein	158972	159214	-	Other genes	n/a
Pdr0g009380	1-aminocyclopropane-1-carboxylate oxidase 1-like	161836	163393	+	Dioxygenase	DIOX_N (E=9.3e-16)
Pdr0g009390	hypothetical protein	164523	168514	-	Other genes	n/a
Pdr0g009400	1-aminocyclopropane-1-carboxylate oxidase 1-like	201347	203294	+	Dioxygenase	DIOX_N (E=1.8e-21)
Pdr0g009410	1-aminocyclopropane-1-carboxylate oxidase 1-like	204595	206139	+	Dioxygenase	DIOX_N (E=4.5e-19)
Pdr0g009420	serine hydroxymethyltransferase 7-like	241562	243872	-	Other genes	n/a
Pdr0g009430	1-aminocyclopropane-1-carboxylate oxidase 1-like	248079	251651	+	Dioxygenase	DIOX_N (E=1.3e-18)
Pdr0g009440	1-aminocyclopropane-1-carboxylate oxidase 1-like	293010	300390	+	Dioxygenase	DIOX_N (E=1.8e-17)
Pdr0g009450	hypothetical protein	302813	303085	+	Other genes	n/a
Pdr0g009460	1-aminocyclopropane-1-carboxylate oxidase 1-like	305354	309737	+	Dioxygenase	DIOX_N (E=2.1e-12), 2OG-FeII_Oxy (E=8.8e-15)
Pdr0g009470	hypothetical protein	310673	310861	+	Other genes	n/a
Pdr0g009480	CASP-like protein	315647	316064	+	Other genes	n/a
Pdr0g009490	auxin-induced protein 5NG4-like	318654	326647	+	Other genes	n/a

Show:

biosynthetic genesother genes

Legend:

Cytochrome 450

Terpene synthase

Copper amine oxidase

Pictet-Spengler enzyme (Bet v1)

Glycosyltransferase

Ketosynthase

Squalene epoxidase

COesterase

Methyltransferase

BAHD acyltransferase

Scl acyltransferase

Epimerase

Oxidoreductase

Dioxygenase

Transporter

CoA-ligase

Amino oxidase

Aminotransferase

Prenyltransferase

Strictosidine synthase-like

PRISE enzymes

Dirigent enzymes

Cellulose synthase-like

Fatty acid desaturase

Lipoxygenase

Polyprenyl synthetase

(Other) Biosynthetic Genes

Other Genes

biosynthetic genes

transport-related genes

regulatory genes

other genes

contig1180 - Cluster 44 - Putative

Gene cluster description

Download cluster GenBank file

contig1180 - Gene Cluster 44. Type = putative. Location: 225008 - 359732 nt. Click on genes for more information.

Show pHMM detection rules used

plants/plant: (minimum(4,[cMT,nMT,oMT,adh_short,Chal_sti_synt_C,Chal_sti_synt_N,COesterase,UDPGT,Glyco_transf_28,Glycos_transf_1,Glycos_transf_2,Lycopene_cycl,NAD_binding_1,p450,SQHop_cyclase_C,SQHop_cyclase_N,Prenyltrans,Terpene_synth_C,Terpene_synth,Transferase,Aminotran_1_2,AMP-binding,DIOX_N,Dirigent,Bet_v_1,Cu_amine_oxid,Str_synth,Trp_syntA,His_biosynth,adh_short_C2,Peptidase_S10,Prenyltransf,Epimerase,2OG-FeII_Oxy,Aminotran_3,Methyltransf_2,Methyltransf_3,Methyltransf_7,PRISE,Cellulose_synt,Chalcone,ERG4_ERG24,FA_desaturase,FA_desaturase_2,Methyltransf_11,polyprenyl_synt,SE,SQS_PSY,TPMT,UbiA,Lipoxygenase,Lyase_aromatic,HMGL-like,Chalcone_3,Chalcone_2,Acetyltransf_1,UDPGT_2,GMC_oxred_N,GMC_oxred_C,Amino_oxidase,DAHP_synth_1,DAHP_synth_2], []))

Genes:

Locus tag	Functional annotation	From	To	Strand	Category	Domains
Pdr0g014800	proline iminopeptidase	219342	226111	+	Other genes	n/a
Pdr0g014810	hypothetical protein	226755	230200	-	Other genes	n/a
Pdr0g014820	squalene monooxygenase-like	238128	240937	+	Squalene epoxidase	SE (E=7.1e-73)
Pdr0g014830	hypothetical protein	288651	288923	+	Other genes	n/a
Pdr0g014840	squalene monooxygenase-like	300727	303885	+	Squalene epoxidase	SE (E=1.3e-72)
Pdr0g014850	squalene monooxygenase-like	313639	314657	+	Squalene epoxidase	SE (E=3.2e-14)
Pdr0g014860	squalene monooxygenase-like	317989	320568	+	Squalene epoxidase	SE (E=6e-69)
Pdr0g014870	hypothetical protein	322612	323049	-	Other genes	n/a
Pdr0g014880	hypothetical protein	327213	335454	+	Other genes	n/a
Pdr0g014890	adenylosuccinate synthetase 2	335928	337889	-	Other genes	n/a
Pdr0g014900	LL-diaminopimelate aminotransferase	343012	346612	-	Aminotransferase	Aminotran_1_2 (E=7.1e-37)
Pdr0g014910	cylicin-2-like	349528	350745	+	Other genes	n/a
Pdr0g014920	DUF21 domain-containing protein	351362	354826	-	Other genes	n/a

Show:

biosynthetic genesother genes

Legend:

Cytochrome 450

Terpene synthase

Copper amine oxidase

Pictet-Spengler enzyme (Bet v1)

Glycosyltransferase

Ketosynthase

Squalene epoxidase

COesterase

Methyltransferase

BAHD acyltransferase

Scl acyltransferase

Epimerase

Oxidoreductase

Dioxygenase

Transporter

CoA-ligase

Amino oxidase

Aminotransferase

Prenyltransferase

Strictosidine synthase-like

PRISE enzymes

Dirigent enzymes

Cellulose synthase-like

Fatty acid desaturase

Lipoxygenase

Polyprenyl synthetase

(Other) Biosynthetic Genes

Other Genes

biosynthetic genes

transport-related genes

regulatory genes

other genes

contig1241 - Cluster 45 - Putative

Gene cluster description

Download cluster GenBank file

contig1241 - Gene Cluster 45. Type = putative. Location: 5391 - 222837 nt. Click on genes for more information.

Show pHMM detection rules used

plants/plant: (minimum(4,[cMT,nMT,oMT,adh_short,Chal_sti_synt_C,Chal_sti_synt_N,COesterase,UDPGT,Glyco_transf_28,Glycos_transf_1,Glycos_transf_2,Lycopene_cycl,NAD_binding_1,p450,SQHop_cyclase_C,SQHop_cyclase_N,Prenyltrans,Terpene_synth_C,Terpene_synth,Transferase,Aminotran_1_2,AMP-binding,DIOX_N,Dirigent,Bet_v_1,Cu_amine_oxid,Str_synth,Trp_syntA,His_biosynth,adh_short_C2,Peptidase_S10,Prenyltransf,Epimerase,2OG-FeII_Oxy,Aminotran_3,Methyltransf_2,Methyltransf_3,Methyltransf_7,PRISE,Cellulose_synt,Chalcone,ERG4_ERG24,FA_desaturase,FA_desaturase_2,Methyltransf_11,polyprenyl_synt,SE,SQS_PSY,TPMT,UbiA,Lipoxygenase,Lyase_aromatic,HMGL-like,Chalcone_3,Chalcone_2,Acetyltransf_1,UDPGT_2,GMC_oxred_N,GMC_oxred_C,Amino_oxidase,DAHP_synth_1,DAHP_synth_2], []))

Genes:

Locus tag	Functional annotation	From	To	Strand	Category	Domains
Pdr0g031870	2-oxoglutarate-dependent dioxygenase AOP2	25404	26797	+	Dioxygenase	DIOX_N (E=2.2e-09)
Pdr0g031880	2-oxoglutarate-dependent dioxygenase AOP1	54664	56864	+	Dioxygenase	DIOX_N (E=7.5e-11)
Pdr0g031890	hypothetical protein	102523	102846	-	Other genes	n/a
Pdr0g031900	gibberellin 3-beta-dioxygenase 1-like	117250	118956	-	Dioxygenase	DIOX_N (E=8e-21)
Pdr0g031910	hypothetical protein	146429	150173	-	Other genes	n/a
Pdr0g031920	60S ribosomal protein L4	154399	155472	+	Other genes	n/a
Pdr0g031930	hypothetical protein	160209	162107	-	Other genes	n/a
Pdr0g031940	katanin p60 ATPase-containing subunit A1	171640	175706	-	Other genes	n/a
Pdr0g031950	glucose-1-phosphate adenylyltransferase large subunit 1	190942	191281	+	Other genes	n/a
Pdr0g031960	hypothetical protein	192166	194503	+	Other genes	n/a
Pdr0g031970	bifunctional aspartate aminotransferase and glutamate/aspartate-prephenate aminotransferase	198522	202824	-	Aminotransferase	Aminotran_1_2 (E=7e-25)
Pdr0g031980	cyclin-A2-4	219951	239386	+	Other genes	n/a

Show:

biosynthetic genesother genes

Legend:

Cytochrome 450

Terpene synthase

Copper amine oxidase

Pictet-Spengler enzyme (Bet v1)

Glycosyltransferase

Ketosynthase

Squalene epoxidase

COesterase

Methyltransferase

BAHD acyltransferase

Scl acyltransferase

Epimerase

Oxidoreductase

Dioxygenase

Transporter

CoA-ligase

Amino oxidase

Aminotransferase

Prenyltransferase

Strictosidine synthase-like

PRISE enzymes

Dirigent enzymes

Cellulose synthase-like

Fatty acid desaturase

Lipoxygenase

Polyprenyl synthetase

(Other) Biosynthetic Genes

Other Genes

biosynthetic genes

transport-related genes

regulatory genes

other genes

contig1241 - Cluster 46 - Saccharide

Gene cluster description

Download cluster GenBank file

contig1241 - Gene Cluster 46. Type = saccharide. Location: 348058 - 417891 nt. Click on genes for more information.

Show pHMM detection rules used

plants/saccharide: (minimum(3,[cMT,nMT,oMT,adh_short,Chal_sti_synt_C,Chal_sti_synt_N,COesterase,UDPGT,Glyco_transf_28,Glycos_transf_1,Glycos_transf_2,Lycopene_cycl,NAD_binding_1,p450,SQHop_cyclase_C,SQHop_cyclase_N,Prenyltrans,Terpene_synth_C,Terpene_synth,Transferase,Aminotran_1_2,AMP-binding,DIOX_N,Dirigent,Bet_v_1,Cu_amine_oxid,Str_synth,Trp_syntA,His_biosynth,adh_short_C2,Peptidase_S10,Prenyltransf,Epimerase,2OG-FeII_Oxy,Aminotran_3,Methyltransf_2,Methyltransf_3,Methyltransf_7,PRISE,Cellulose_synt,Chalcone,ERG4_ERG24,FA_desaturase,FA_desaturase_2,Methyltransf_11,polyprenyl_synt,SE,SQS_PSY,TPMT,UbiA,Lipoxygenase,Lyase_aromatic,HMGL-like,Chalcone_3,Chalcone_2,Acetyltransf_1,UDPGT_2,GMC_oxred_N,GMC_oxred_C,Amino_oxidase,DAHP_synth_1,DAHP_synth_2], [Glycos_transf_1/Glycos_transf_2/Glycos_transf_28/UDPGT/UDPGT_2]))

Genes:

Locus tag	Functional annotation	From	To	Strand	Category	Domains
Pdr0g032100	F-box/kelch-repeat protein	346681	349819	+	Other genes	n/a
Pdr0g032110	hypothetical protein	358099	362012	-	Glycosyltransferase	Glycos_transf_1 (E=2e-14)
Pdr0g032120	hypothetical protein	365054	369510	-	Other genes	n/a
Pdr0g032130	acetyltransferase	395978	397345	-	BAHD acyltransferase	Transferase (E=3.9e-80)
Pdr0g032140	shikimate O-hydroxycinnamoyltransferase-like	407281	407850	+	BAHD acyltransferase	Transferase (E=4.6e-09)
Pdr0g032150	hypothetical protein	410398	410864	+	Other genes	n/a

Show:

biosynthetic genesother genes

Legend:

Cytochrome 450

Terpene synthase

Copper amine oxidase

Pictet-Spengler enzyme (Bet v1)

Glycosyltransferase

Ketosynthase

Squalene epoxidase

COesterase

Methyltransferase

BAHD acyltransferase

Scl acyltransferase

Epimerase

Oxidoreductase

Dioxygenase

Transporter

CoA-ligase

Amino oxidase

Aminotransferase

Prenyltransferase

Strictosidine synthase-like

PRISE enzymes

Dirigent enzymes

Cellulose synthase-like

Fatty acid desaturase

Lipoxygenase

Polyprenyl synthetase

(Other) Biosynthetic Genes

Other Genes

biosynthetic genes

transport-related genes

regulatory genes

other genes